BLASTX nr result
ID: Mentha26_contig00043493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043493 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37311.1| hypothetical protein MIMGU_mgv1a009465mg [Mimulus... 77 3e-12 ref|XP_006344540.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_004242906.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|EPS73575.1| hypothetical protein M569_01175 [Genlisea aurea] 68 1e-09 ref|XP_007014231.1| Tetratricopeptide repeat (TPR)-like superfam... 67 3e-09 gb|EXC05166.1| hypothetical protein L484_003973 [Morus notabilis] 63 4e-08 ref|XP_007214935.1| hypothetical protein PRUPE_ppa001374mg [Prun... 63 4e-08 ref|XP_006296987.1| hypothetical protein CARUB_v10012981mg [Caps... 62 8e-08 ref|XP_006381785.1| pentatricopeptide repeat-containing family p... 62 8e-08 ref|XP_006409097.1| hypothetical protein EUTSA_v10022551mg [Eutr... 62 1e-07 ref|XP_002267263.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CAN75494.1| hypothetical protein VITISV_030525 [Vitis vinifera] 61 1e-07 ref|XP_006453335.1| hypothetical protein CICLE_v10007460mg [Citr... 60 3e-07 ref|XP_002884184.1| pentatricopeptide repeat-containing protein ... 59 5e-07 ref|NP_179484.1| pentatricopeptide repeat-containing protein [Ar... 59 5e-07 ref|XP_004487947.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_003594946.1| Pentatricopeptide repeat-containing protein ... 56 5e-06 >gb|EYU37311.1| hypothetical protein MIMGU_mgv1a009465mg [Mimulus guttatus] Length = 341 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = +3 Query: 3 TIIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 TI+DGYCKAK+YKDAMEFV+R++E+D Y E++ QRL SR+RENMES Sbjct: 295 TIVDGYCKAKKYKDAMEFVSRIKEKDGLYGEESTQRLVSRIRENMES 341 >ref|XP_006344540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Solanum tuberosum] Length = 842 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = +3 Query: 3 TIIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 TI+DGYCKAKRY+DAM+FV ++E+D ++ E++LQR ASRVRENMES Sbjct: 796 TIVDGYCKAKRYQDAMDFVLNIKEKDNTFDEESLQRFASRVRENMES 842 >ref|XP_004242906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940-like [Solanum lycopersicum] Length = 842 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = +3 Query: 3 TIIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 TI+DGYCKAKRY+DAM+FV ++E+D ++ E++LQR ASRVRENMES Sbjct: 796 TIVDGYCKAKRYQDAMDFVLNIKEKDNTFDEESLQRFASRVRENMES 842 >gb|EPS73575.1| hypothetical protein M569_01175 [Genlisea aurea] Length = 760 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYCKA+R KDAM+FV R+RE D Y E+ LQRL RVREN++S Sbjct: 714 VVDGYCKARRSKDAMDFVGRIRERDGGYGEEGLQRLVYRVRENLQS 759 >ref|XP_007014231.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508784594|gb|EOY31850.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 845 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/46 (58%), Positives = 41/46 (89%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYCKA+RYK+AM+FV++++E D S+ EQ++ RLA RVREN++S Sbjct: 800 VVDGYCKARRYKEAMDFVSKIKEIDDSFDEQSIDRLAFRVRENLDS 845 >gb|EXC05166.1| hypothetical protein L484_003973 [Morus notabilis] Length = 807 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYCKA RYK+AM+FV+ ++E D S+ + ++QRLASR+RE ++S Sbjct: 762 VVDGYCKAGRYKEAMDFVSNIKEVDNSFDDHSVQRLASRIREKLDS 807 >ref|XP_007214935.1| hypothetical protein PRUPE_ppa001374mg [Prunus persica] gi|462411085|gb|EMJ16134.1| hypothetical protein PRUPE_ppa001374mg [Prunus persica] Length = 842 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/45 (55%), Positives = 40/45 (88%) Frame = +3 Query: 9 IDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 +DGYCKA++YK+AM+F+++++E D S+ +Q +QRLASR+R N+ES Sbjct: 798 VDGYCKARKYKEAMDFLSKIKEIDNSFDDQYVQRLASRIRGNLES 842 >ref|XP_006296987.1| hypothetical protein CARUB_v10012981mg [Capsella rubella] gi|482565696|gb|EOA29885.1| hypothetical protein CARUB_v10012981mg [Capsella rubella] Length = 832 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYC+A +Y +AM+FV +++ DAS+ +Q++QRLA RVREN+ES Sbjct: 787 VVDGYCRAGKYSEAMDFVYKIKTFDASFDDQSIQRLALRVRENLES 832 >ref|XP_006381785.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336541|gb|ERP59582.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 821 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/46 (54%), Positives = 40/46 (86%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYCKAK++K+AM+FV+ + + D S+ Q+++RL+SRVRENM+S Sbjct: 776 VVDGYCKAKKFKEAMDFVSTITDIDDSFDYQSMRRLSSRVRENMQS 821 >ref|XP_006409097.1| hypothetical protein EUTSA_v10022551mg [Eutrema salsugineum] gi|557110259|gb|ESQ50550.1| hypothetical protein EUTSA_v10022551mg [Eutrema salsugineum] Length = 838 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/46 (52%), Positives = 39/46 (84%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYC+A RY +AM+FV++++ DA + +Q++QRLA RVR+N+ES Sbjct: 793 VVDGYCRAGRYSEAMDFVSKIKTLDAYFDDQSIQRLAQRVRDNLES 838 >ref|XP_002267263.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940 [Vitis vinifera] gi|297735424|emb|CBI17864.3| unnamed protein product [Vitis vinifera] Length = 821 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/45 (53%), Positives = 37/45 (82%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENME 140 ++DGYCK K+YK+AM+FV+ + E D S+ +Q+L+RL R+RE+ME Sbjct: 776 VVDGYCKGKKYKEAMDFVSNITEMDKSFDDQSLRRLTFRIREHME 820 >emb|CAN75494.1| hypothetical protein VITISV_030525 [Vitis vinifera] Length = 821 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/45 (53%), Positives = 37/45 (82%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENME 140 ++DGYCK K+YK+AM+FV+ + E D S+ +Q+L+RL R+RE+ME Sbjct: 776 VVDGYCKGKKYKEAMDFVSNITEMDKSFDDQSLRRLTFRIREHME 820 >ref|XP_006453335.1| hypothetical protein CICLE_v10007460mg [Citrus clementina] gi|567922660|ref|XP_006453336.1| hypothetical protein CICLE_v10007460mg [Citrus clementina] gi|568840495|ref|XP_006474202.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Citrus sinensis] gi|557556561|gb|ESR66575.1| hypothetical protein CICLE_v10007460mg [Citrus clementina] gi|557556562|gb|ESR66576.1| hypothetical protein CICLE_v10007460mg [Citrus clementina] Length = 824 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/46 (47%), Positives = 40/46 (86%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYCKA++YK+AM+F+++++E D S+ +++++RL RVRE +ES Sbjct: 779 VVDGYCKARKYKEAMDFLSKIKERDDSFNDESVKRLTFRVREILES 824 >ref|XP_002884184.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330024|gb|EFH60443.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 829 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/46 (50%), Positives = 38/46 (82%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYC+A +Y +AM+FV++++ D + +Q++QRLA RVREN+ES Sbjct: 784 VVDGYCRAGKYSEAMDFVSKIKTFDPCFDDQSIQRLALRVRENLES 829 >ref|NP_179484.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75099137|sp|O64624.1|PP163_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g18940, chloroplastic; Flags: Precursor gi|3004555|gb|AAC09028.1| putative salt-inducible protein [Arabidopsis thaliana] gi|15983785|gb|AAL10489.1| At2g18940/F19F24.14 [Arabidopsis thaliana] gi|38564280|gb|AAR23719.1| At2g18940/F19F24.14 [Arabidopsis thaliana] gi|330251736|gb|AEC06830.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 822 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/46 (50%), Positives = 38/46 (82%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 ++DGYC+A +Y +AM+FV++++ D + +Q++QRLA RVREN+ES Sbjct: 777 VVDGYCRAGKYSEAMDFVSKIKTFDPCFDDQSIQRLALRVRENLES 822 >ref|XP_004487947.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940-like [Cicer arietinum] Length = 840 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/44 (47%), Positives = 40/44 (90%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENM 137 +IDGYCKAK++K+A++FV++++E D S+ +Q+++RLAS ++E++ Sbjct: 795 VIDGYCKAKKHKEALDFVSKIKEVDISFDDQSVKRLASCIKESL 838 >ref|XP_003594946.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124359380|gb|ABN05846.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355483994|gb|AES65197.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 849 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/46 (50%), Positives = 40/46 (86%) Frame = +3 Query: 6 IIDGYCKAKRYKDAMEFVARVREEDASYTEQALQRLASRVRENMES 143 +IDGY KAK++K+AM+FV++++E D S+ +Q+L++LAS +RE++ S Sbjct: 804 VIDGYIKAKKHKEAMDFVSKIKEIDISFDDQSLKKLASCIRESLGS 849