BLASTX nr result
ID: Mentha26_contig00043453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043453 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018344.1| Nbs-lrr resistance protein, putative [Theobr... 59 7e-07 >ref|XP_007018344.1| Nbs-lrr resistance protein, putative [Theobroma cacao] gi|508723672|gb|EOY15569.1| Nbs-lrr resistance protein, putative [Theobroma cacao] Length = 1195 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/91 (38%), Positives = 58/91 (63%) Frame = +3 Query: 9 RSKVQRTNPCLSLIPLSNYYYMPPKLKSLQGRLDDLVAKMSSFRLKETASTSQLNRSQTF 188 R +V+ T+ L I S + M KL + RLDD+ +MS+F+ +E + +L+ T Sbjct: 125 RRQVRITSFALQSILSS--FEMSRKLTEIVERLDDIAREMSTFQFREVKAYKRLD---TM 179 Query: 189 ERRETGYYVDESDVVGRAVDLERLVSLVMPS 281 E+RETG Y+DES+V GR+ D++++V L++ S Sbjct: 180 EKRETGPYMDESEVYGRSEDVKKIVDLLLSS 210