BLASTX nr result
ID: Mentha26_contig00043361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043361 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34416.1| hypothetical protein MIMGU_mgv1a007896mg [Mimulus... 63 5e-08 >gb|EYU34416.1| hypothetical protein MIMGU_mgv1a007896mg [Mimulus guttatus] Length = 392 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = -3 Query: 196 FTFHSSVKPKIGDDETVVRSGLYCDEGGEEEFGRKIKFATPRPISGDALGALLEQKLKEL 17 F F+SS K + G+ E VRS LY D+G K++ A P P+SGDALGA+LEQKLKEL Sbjct: 14 FKFNSSAKQRSGNAERKVRSNLYFDDGRRA----KLENAAPPPLSGDALGAILEQKLKEL 69 Query: 16 N 14 N Sbjct: 70 N 70