BLASTX nr result
ID: Mentha26_contig00043346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043346 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 58 1e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 1/103 (0%) Frame = -3 Query: 363 LVEYHGLLGAIGYDITSSEISSSKGFQLWVREESSWAKVFDVV-LPGVERPLGLKDGQWL 187 L++++G LGAI Y +E K LWV SW + F + + GVERPLG L Sbjct: 268 LLDFNGSLGAIVYPREGTE----KSIDLWVMN-GSWTRQFSIESVSGVERPLGFWKNGEL 322 Query: 186 FLEGNNCNELSQLLVYDWILKDLKELGIYDDPDQMNVTFYVES 58 FLE +N +L+++D ++LK LGI+ + M + YVES Sbjct: 323 FLESSN----HELVLFDPATRELKNLGIHAYQNTMQLIAYVES 361