BLASTX nr result
ID: Mentha26_contig00043318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043318 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19673.1| hypothetical protein MIMGU_mgv1a027053mg [Mimulus... 72 6e-11 >gb|EYU19673.1| hypothetical protein MIMGU_mgv1a027053mg [Mimulus guttatus] Length = 470 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 383 KEGQNGIHPMKDIKNLYGFLRAKSSRKASMDKFDIDINDRENSVHG 246 KEGQ+GIHPMK+IKNLYG LRA+SSRKAS+DKFD+D + SVHG Sbjct: 425 KEGQSGIHPMKEIKNLYGLLRARSSRKASLDKFDVD-PENSGSVHG 469