BLASTX nr result
ID: Mentha26_contig00043295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043295 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73967.1| hypothetical protein M569_00791, partial [Genlise... 57 3e-06 gb|EYU28983.1| hypothetical protein MIMGU_mgv1a012937mg [Mimulus... 57 3e-06 gb|EYU28982.1| hypothetical protein MIMGU_mgv1a012937mg [Mimulus... 57 3e-06 ref|XP_006363732.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 56 4e-06 ref|XP_004245711.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 56 4e-06 ref|XP_004245710.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 56 4e-06 ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 55 8e-06 >gb|EPS73967.1| hypothetical protein M569_00791, partial [Genlisea aurea] Length = 181 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VKKI+KLSAIGEQ+RLD KK+ SQKK+ RRSRD +D Sbjct: 146 VKKIQKLSAIGEQKRLDKKKAQSQKKSFRRSRDGYD 181 >gb|EYU28983.1| hypothetical protein MIMGU_mgv1a012937mg [Mimulus guttatus] Length = 225 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VKKI KLSAI E +RLD+KK+ SQKKA+RRSRD WD Sbjct: 190 VKKIAKLSAISENKRLDSKKALSQKKAVRRSRDGWD 225 >gb|EYU28982.1| hypothetical protein MIMGU_mgv1a012937mg [Mimulus guttatus] Length = 235 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VKKI KLSAI E +RLD+KK+ SQKKA+RRSRD WD Sbjct: 200 VKKIAKLSAISENKRLDSKKALSQKKAVRRSRDGWD 235 >ref|XP_006363732.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like [Solanum tuberosum] Length = 238 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VK+I KL+AIGE++RLD KK+ SQKKA+RRSRDS+D Sbjct: 203 VKRITKLAAIGERKRLDNKKAQSQKKAMRRSRDSYD 238 >ref|XP_004245711.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 238 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VK+I KL+AIGE++RLD KK+ SQKKA+RRSRDS+D Sbjct: 203 VKRITKLAAIGERKRLDNKKAQSQKKAMRRSRDSYD 238 >ref|XP_004245710.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 251 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 VKKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 VK+I KL+AIGE++RLD KK+ SQKKA+RRSRDS+D Sbjct: 216 VKRITKLAAIGERKRLDNKKAQSQKKAMRRSRDSYD 251 >ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial [Vitis vinifera] gi|296082846|emb|CBI22147.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 KKIKKLSAIGEQRRLDTKKSNSQKKALRRSRDSWD 108 KKI KL+AIGEQ+RL KK SQKKA RRSRDSWD Sbjct: 196 KKIAKLAAIGEQKRLQNKKVLSQKKAFRRSRDSWD 230