BLASTX nr result
ID: Mentha26_contig00043280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043280 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41573.1| hypothetical protein MIMGU_mgv1a013367mg [Mimulus... 72 1e-10 gb|EYU41575.1| hypothetical protein MIMGU_mgv1a013382mg [Mimulus... 71 1e-10 gb|EYU22337.1| hypothetical protein MIMGU_mgv1a026864mg, partial... 71 1e-10 ref|XP_002263868.1| PREDICTED: vacuolar protein-sorting-associat... 69 7e-10 ref|XP_006452879.1| hypothetical protein CICLE_v10009355mg [Citr... 68 2e-09 ref|XP_006474592.1| PREDICTED: vacuolar protein-sorting-associat... 67 3e-09 ref|XP_007027532.1| Modifier of rudimentary (Mod(r)) protein [Th... 65 8e-09 ref|XP_003625741.1| Vacuolar protein-sorting-associated protein-... 64 2e-08 ref|XP_003625740.1| Vacuolar protein-sorting-associated protein-... 64 2e-08 ref|XP_003625739.1| Vacuolar protein-sorting-associated protein-... 64 2e-08 ref|XP_003625738.1| Vacuolar protein-sorting-associated protein-... 64 2e-08 ref|XP_006381351.1| hypothetical protein POPTR_0006s12080g [Popu... 63 4e-08 ref|XP_002519434.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|XP_002323492.1| hypothetical protein POPTR_0016s10930g [Popu... 63 5e-08 ref|XP_007202510.1| hypothetical protein PRUPE_ppa010815mg [Prun... 62 8e-08 gb|AAS21018.1| autophagy protein AGP6 [Hyacinthus orientalis] 62 8e-08 ref|XP_006339099.1| PREDICTED: vacuolar protein-sorting-associat... 62 1e-07 ref|XP_004304325.1| PREDICTED: vacuolar protein-sorting-associat... 62 1e-07 ref|XP_006576145.1| PREDICTED: uncharacterized protein LOC100305... 61 2e-07 ref|XP_006391880.1| hypothetical protein EUTSA_v10023701mg [Eutr... 61 2e-07 >gb|EYU41573.1| hypothetical protein MIMGU_mgv1a013367mg [Mimulus guttatus] Length = 222 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQTPV 256 ESE LHRQLLD E+D+ AFVQKYKKMR TYHKRAL HLA +T V Sbjct: 177 ESETLHRQLLDGEIDLPAFVQKYKKMRYTYHKRALVHLAAKTTV 220 >gb|EYU41575.1| hypothetical protein MIMGU_mgv1a013382mg [Mimulus guttatus] Length = 222 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQTPV 256 ESE LHRQLLD E+D+ AFVQKYKKMR TYHKRAL HLA +T V Sbjct: 177 ESETLHRQLLDGEIDLPAFVQKYKKMRYTYHKRALIHLAAKTTV 220 >gb|EYU22337.1| hypothetical protein MIMGU_mgv1a026864mg, partial [Mimulus guttatus] Length = 216 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQTPV 256 ESE LHRQLLD E+D+ AFVQKYKKMR TYHKRAL HLA +T V Sbjct: 171 ESETLHRQLLDGEIDLPAFVQKYKKMRYTYHKRALIHLAAKTTV 214 >ref|XP_002263868.1| PREDICTED: vacuolar protein-sorting-associated protein 37 homolog 2 [Vitis vinifera] gi|297740010|emb|CBI30192.3| unnamed protein product [Vitis vinifera] Length = 233 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LHRQLLD E+D+ AFVQKYK++R TYH+RALTHLA +T Sbjct: 188 ESETLHRQLLDREMDLGAFVQKYKRLRTTYHRRALTHLAAKT 229 >ref|XP_006452879.1| hypothetical protein CICLE_v10009355mg [Citrus clementina] gi|557556105|gb|ESR66119.1| hypothetical protein CICLE_v10009355mg [Citrus clementina] Length = 235 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LHRQLLD ELDI AFVQKYKK+R TYH+RAL HL+ +T Sbjct: 186 ESENLHRQLLDRELDIGAFVQKYKKLRTTYHRRALVHLSAKT 227 >ref|XP_006474592.1| PREDICTED: vacuolar protein-sorting-associated protein 37 homolog 1-like [Citrus sinensis] Length = 235 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LHRQLLD ELD+ AFVQKYKK+R TYH+RAL HL+ +T Sbjct: 186 ESENLHRQLLDRELDVGAFVQKYKKLRTTYHRRALIHLSAKT 227 >ref|XP_007027532.1| Modifier of rudimentary (Mod(r)) protein [Theobroma cacao] gi|508716137|gb|EOY08034.1| Modifier of rudimentary (Mod(r)) protein [Theobroma cacao] Length = 232 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 E EALHRQLLD E+D+ FVQKYKK+R TYH+RAL HLA +T Sbjct: 187 ELEALHRQLLDREMDLGTFVQKYKKLRTTYHRRALIHLAAKT 228 >ref|XP_003625741.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] gi|355500756|gb|AES81959.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] Length = 141 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QLLD E+D+ AF+QKYKK+R TYHKR L HLA +T Sbjct: 97 ESENLHQQLLDREVDLAAFLQKYKKLRTTYHKRTLIHLAAKT 138 >ref|XP_003625740.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] gi|355500755|gb|AES81958.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] Length = 124 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QLLD E+D+ AF+QKYKK+R TYHKR L HLA +T Sbjct: 80 ESENLHQQLLDREVDLAAFLQKYKKLRTTYHKRTLIHLAAKT 121 >ref|XP_003625739.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] gi|355500754|gb|AES81957.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] Length = 236 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QLLD E+D+ AF+QKYKK+R TYHKR L HLA +T Sbjct: 192 ESENLHQQLLDREVDLAAFLQKYKKLRTTYHKRTLIHLAAKT 233 >ref|XP_003625738.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] gi|355500753|gb|AES81956.1| Vacuolar protein-sorting-associated protein-like protein [Medicago truncatula] gi|388505386|gb|AFK40759.1| unknown [Medicago truncatula] Length = 220 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QLLD E+D+ AF+QKYKK+R TYHKR L HLA +T Sbjct: 176 ESENLHQQLLDREVDLAAFLQKYKKLRTTYHKRTLIHLAAKT 217 >ref|XP_006381351.1| hypothetical protein POPTR_0006s12080g [Populus trichocarpa] gi|550336053|gb|ERP59148.1| hypothetical protein POPTR_0006s12080g [Populus trichocarpa] Length = 233 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLA 271 ESEALHRQ LD E+D+ +FV KYKK+R TYHKRAL HLA Sbjct: 188 ESEALHRQFLDKEIDLGSFVLKYKKLRTTYHKRALIHLA 226 >ref|XP_002519434.1| conserved hypothetical protein [Ricinus communis] gi|223541297|gb|EEF42848.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QLLD E+++ AFVQKYKK+R TYH+R L HLA +T Sbjct: 184 ESEILHKQLLDREIELLAFVQKYKKLRATYHRRTLIHLAGKT 225 >ref|XP_002323492.1| hypothetical protein POPTR_0016s10930g [Populus trichocarpa] gi|222868122|gb|EEF05253.1| hypothetical protein POPTR_0016s10930g [Populus trichocarpa] Length = 230 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLA 271 ES+A HRQ L+ E+D+ AFVQKYKK+R TYHKRAL HLA Sbjct: 185 ESDAFHRQFLEKEMDLGAFVQKYKKLRTTYHKRALIHLA 223 >ref|XP_007202510.1| hypothetical protein PRUPE_ppa010815mg [Prunus persica] gi|462398041|gb|EMJ03709.1| hypothetical protein PRUPE_ppa010815mg [Prunus persica] Length = 235 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+QL+D E+D+ FV+KYKK+R TYH+RAL HLA +T Sbjct: 190 ESENLHQQLIDREVDLGGFVEKYKKLRTTYHRRALVHLAAKT 231 >gb|AAS21018.1| autophagy protein AGP6 [Hyacinthus orientalis] Length = 176 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQTPV 256 ESE LH +L++ ++D+ FVQKYKK+R TYH+RALTHLA +T + Sbjct: 132 ESEVLHNKLVEKDIDLVTFVQKYKKLRNTYHRRALTHLAAKTSI 175 >ref|XP_006339099.1| PREDICTED: vacuolar protein-sorting-associated protein 37 homolog 1-like [Solanum tuberosum] Length = 233 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQTPV 256 ESE L +QLL+ E+D+ FVQKYKK+R +YHKRALTHLA +T + Sbjct: 188 ESENLDKQLLEGEIDLATFVQKYKKLRQSYHKRALTHLAAKTSI 231 >ref|XP_004304325.1| PREDICTED: vacuolar protein-sorting-associated protein 37 homolog 2-like [Fragaria vesca subsp. vesca] Length = 225 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LHRQLL++E+D+ FV KYKK+R TYH+RAL HLA +T Sbjct: 180 ESEDLHRQLLNSEIDLGTFVPKYKKLRNTYHRRALVHLAAKT 221 >ref|XP_006576145.1| PREDICTED: uncharacterized protein LOC100305851 isoform X1 [Glycine max] Length = 221 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESE LH+ LLD E+D+ AF+QKYKK+R TYH++ L HLA +T Sbjct: 177 ESENLHQHLLDREIDLAAFLQKYKKLRTTYHRKTLVHLAAKT 218 >ref|XP_006391880.1| hypothetical protein EUTSA_v10023701mg [Eutrema salsugineum] gi|557088386|gb|ESQ29166.1| hypothetical protein EUTSA_v10023701mg [Eutrema salsugineum] Length = 198 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 387 ESEALHRQLLDTELDITAFVQKYKKMRITYHKRALTHLAMQT 262 ESEAL + L+ E+D+ AFVQKYKK+R TYH+RAL HLA +T Sbjct: 153 ESEALQEKFLEKEIDVAAFVQKYKKLRTTYHRRALIHLAAKT 194