BLASTX nr result
ID: Mentha26_contig00043258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043258 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGM32529.1| BTG1-like protein [Coptotermes formosanus] 60 4e-07 >gb|AGM32529.1| BTG1-like protein [Coptotermes formosanus] Length = 184 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -1 Query: 144 MHLELESAANFLLNLLRLHSH-IVVDKLELFRESLLRILHGHYHQHWFP 1 M LE+ SAANFL++LLRLH++ + +LE+FR SL +L G Y +HWFP Sbjct: 1 MRLEIHSAANFLVHLLRLHNNGLTESQLEMFRSSLTDVLRGRYQEHWFP 49