BLASTX nr result
ID: Mentha26_contig00043130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00043130 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46774.1| hypothetical protein MIMGU_mgv1a015756mg [Mimulus... 84 3e-14 gb|EPS65324.1| hypothetical protein M569_09453, partial [Genlise... 80 3e-13 gb|EPS59019.1| hypothetical protein M569_15792 [Genlisea aurea] 74 3e-11 ref|XP_006444441.1| hypothetical protein CICLE_v10022679mg [Citr... 66 6e-09 ref|XP_002302741.1| hypothetical protein POPTR_0002s20100g [Popu... 62 8e-08 ref|XP_002320323.1| mitochondrial carrier family protein [Populu... 58 2e-06 ref|XP_007051039.1| Uncharacterized protein TCM_004747 [Theobrom... 57 2e-06 gb|EXB95715.1| hypothetical protein L484_007465 [Morus notabilis] 57 3e-06 >gb|EYU46774.1| hypothetical protein MIMGU_mgv1a015756mg [Mimulus guttatus] Length = 147 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 312 RPTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGSEITCRR 190 RP KEYDERMI+EIYKSIVMAQGQ+VPRDAAWIGSEITCRR Sbjct: 107 RPVKEYDERMIVEIYKSIVMAQGQIVPRDAAWIGSEITCRR 147 >gb|EPS65324.1| hypothetical protein M569_09453, partial [Genlisea aurea] Length = 152 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 315 VRPTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGSEITCRR 190 VRP KEYDERMI+EIY+SIVMAQGQ+VPRDA WIGSEI CRR Sbjct: 111 VRPMKEYDERMIVEIYRSIVMAQGQIVPRDAVWIGSEIACRR 152 >gb|EPS59019.1| hypothetical protein M569_15792 [Genlisea aurea] Length = 146 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 315 VRPTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGSEITCRR 190 VRP KEYD+RMI++IY+SIV+AQGQ+VPRDAAWIGSEI RR Sbjct: 97 VRPIKEYDQRMIMDIYRSIVLAQGQIVPRDAAWIGSEIASRR 138 >ref|XP_006444441.1| hypothetical protein CICLE_v10022679mg [Citrus clementina] gi|568852744|ref|XP_006480031.1| PREDICTED: uncharacterized protein LOC102622463 [Citrus sinensis] gi|557546703|gb|ESR57681.1| hypothetical protein CICLE_v10022679mg [Citrus clementina] Length = 151 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -2 Query: 309 PTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGSEITCR 193 P KEYDE++I++IYKS+VMAQGQLVPRDAA +GS++ CR Sbjct: 112 PLKEYDEKVIVDIYKSLVMAQGQLVPRDAARLGSQVVCR 150 >ref|XP_002302741.1| hypothetical protein POPTR_0002s20100g [Populus trichocarpa] gi|222844467|gb|EEE82014.1| hypothetical protein POPTR_0002s20100g [Populus trichocarpa] Length = 148 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 312 RPTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGS 208 RP KEYDE+MIIEIYKS+VMAQGQLVPRDA +GS Sbjct: 105 RPIKEYDEKMIIEIYKSLVMAQGQLVPRDAPTLGS 139 >ref|XP_002320323.1| mitochondrial carrier family protein [Populus trichocarpa] gi|222861096|gb|EEE98638.1| mitochondrial carrier family protein [Populus trichocarpa] Length = 148 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 312 RPTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGS 208 RP KEYDE+MI++IYKS+VM QGQLVP DAA GS Sbjct: 105 RPIKEYDEKMIVQIYKSLVMTQGQLVPHDAARFGS 139 >ref|XP_007051039.1| Uncharacterized protein TCM_004747 [Theobroma cacao] gi|508703300|gb|EOX95196.1| Uncharacterized protein TCM_004747 [Theobroma cacao] Length = 142 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 309 PTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGSEITCR 193 P KEYDE++I+EIYKS+VM QGQLVPR+A + S I C+ Sbjct: 103 PMKEYDEKVIVEIYKSLVMGQGQLVPREAGKLSSAIICQ 141 >gb|EXB95715.1| hypothetical protein L484_007465 [Morus notabilis] Length = 139 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 309 PTKEYDERMIIEIYKSIVMAQGQLVPRDAAWIGS 208 P KEYD++MI+EIYKS+V+A GQLVPRDAA +GS Sbjct: 106 PLKEYDDKMIVEIYKSLVLAHGQLVPRDAARLGS 139