BLASTX nr result
ID: Mentha26_contig00042924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042924 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGT55822.1| tempranillo [Antirrhinum majus] 62 8e-08 ref|XP_006484413.1| PREDICTED: AP2/ERF and B3 domain-containing ... 56 5e-06 ref|XP_006437734.1| hypothetical protein CICLE_v10031846mg [Citr... 56 5e-06 >gb|AGT55822.1| tempranillo [Antirrhinum majus] Length = 354 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = +1 Query: 22 PQPMKPSEKLCRVGRGASVIIDDAESGL--ESKKLPSSRFKGVVPQ 153 PQP P +KLCRVG G SVI+D AE G+ ES+KLPSSRFKGVVPQ Sbjct: 23 PQP-PPPDKLCRVGSGTSVILDAAECGVEAESRKLPSSRFKGVVPQ 67 >ref|XP_006484413.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Citrus sinensis] Length = 377 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = +1 Query: 28 PMKPSEKLCRVGRGASVIIDDAESGL--ESKKLPSSRFKGVVPQ 153 P K E LCRVG GAS +I D+E+G+ ES+KLPSS++KGVVPQ Sbjct: 34 PTKSPESLCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQ 77 >ref|XP_006437734.1| hypothetical protein CICLE_v10031846mg [Citrus clementina] gi|557539930|gb|ESR50974.1| hypothetical protein CICLE_v10031846mg [Citrus clementina] Length = 377 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = +1 Query: 28 PMKPSEKLCRVGRGASVIIDDAESGL--ESKKLPSSRFKGVVPQ 153 P K E LCRVG GAS +I D+E+G+ ES+KLPSS++KGVVPQ Sbjct: 34 PTKSPESLCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQ 77