BLASTX nr result
ID: Mentha26_contig00042908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042908 (1043 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 50 7e-07 >ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] gi|223536193|gb|EEF37846.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] Length = 624 Score = 50.1 bits (118), Expect(2) = 7e-07 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +3 Query: 777 QEYGYTSDKLCYF*NVNSSNYTILHDEVSDTCSYEERASM 896 Q Y Y DK CYF NV+SSNYTIL+D+V + C+ +E++ + Sbjct: 558 QVYKYDGDKFCYFRNVSSSNYTILYDKVGNKCNKKEQSHL 597 Score = 30.8 bits (68), Expect(2) = 7e-07 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 640 VILGFNEKVKKSFYYGTWRSELECAQ-CPRLHACEENLVISGEGSTHK 780 V LGFNEK K +G S L+ Q + + NLV++G GST + Sbjct: 511 VTLGFNEKKSKDSSFGFDTSSLKNLQNAQGVMVVKNNLVVNGVGSTQQ 558