BLASTX nr result
ID: Mentha26_contig00042906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042906 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35944.1| hypothetical protein MIMGU_mgv1a011982mg [Mimulus... 56 6e-06 >gb|EYU35944.1| hypothetical protein MIMGU_mgv1a011982mg [Mimulus guttatus] Length = 265 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 7/65 (10%) Frame = -2 Query: 176 MSAAVEVVGTAL----RDLAINFEPETEGNSTATSEETNQGGCDTN---SSNINSHHGVC 18 MSA VE++G L + L + + + +GN TA EE N+ CD N ++N N+HHG+C Sbjct: 1 MSAPVEIIGQNLIEDLQHLTVEDQNKMKGNCTAAVEEINRVECDANDTTNNNNNNHHGIC 60 Query: 17 AICLN 3 AICLN Sbjct: 61 AICLN 65