BLASTX nr result
ID: Mentha26_contig00042884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042884 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42925.1| hypothetical protein MIMGU_mgv1a001865mg [Mimulus... 70 3e-10 >gb|EYU42925.1| hypothetical protein MIMGU_mgv1a001865mg [Mimulus guttatus] Length = 747 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = +3 Query: 255 MQKSGSLSKHXXXXXXXXXXXXXXGLCSQVSTAQQTSPVVFPEKRNSRGKSSKGGE 422 MQKSGSLSK+ GLCSQV+T QQTSPVVFPEKRNSRGK++K G+ Sbjct: 1 MQKSGSLSKNSSLRLSTQQSLRRLGLCSQVTTGQQTSPVVFPEKRNSRGKAAKSGD 56