BLASTX nr result
ID: Mentha26_contig00042695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042695 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31153.1| hypothetical protein MIMGU_mgv1a001983mg [Mimulus... 60 4e-07 >gb|EYU31153.1| hypothetical protein MIMGU_mgv1a001983mg [Mimulus guttatus] Length = 730 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/51 (66%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = +1 Query: 142 GQNLATVSEIIRSTEAGSSRSQHPESLDDDSMS-VEESEIDDDVPYYSDIE 291 G N AT+SEI +STEAGS R+ PES+ +DS+S EES+IDDDVPY+SDIE Sbjct: 495 GDNPATMSEI-QSTEAGSVRTPIPESVVNDSVSDQEESQIDDDVPYFSDIE 544