BLASTX nr result
ID: Mentha26_contig00042692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042692 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus... 72 6e-11 >gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus guttatus] Length = 510 Score = 72.4 bits (176), Expect = 6e-11 Identities = 44/109 (40%), Positives = 62/109 (56%), Gaps = 3/109 (2%) Frame = +2 Query: 2 KKASTASELTQEDVGPDKKTVDEEKSGDAKEPV-PTPRVRKPCTWLKLDRL-NXXXXXXX 175 K A+E T E+ D+KT + +K+ D KE V P+ +KPCTWLKLDRL Sbjct: 21 KNGKKAAESTLEEEVSDRKTAEGKKASDVKESVSPSMVKKKPCTWLKLDRLVPQTEKKSS 80 Query: 176 XXXXXQDKEAKPIVQVRALEDNKRKRNDTREEKVHSHPVTNGTQ-NSHH 319 Q KEAK ++V+ +DNKRKR + EE+ ++HP + +SHH Sbjct: 81 VESIKQGKEAKISIEVQRTKDNKRKRTEKSEEEGNNHPKYHEKYIDSHH 129