BLASTX nr result
ID: Mentha26_contig00042610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042610 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37749.1| hypothetical protein MIMGU_mgv1a003201mg [Mimulus... 61 1e-07 >gb|EYU37749.1| hypothetical protein MIMGU_mgv1a003201mg [Mimulus guttatus] Length = 600 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -1 Query: 315 GDLIETGQPSASGTSSKCSQLSRKRPRK-ESNTGSVIDLNLPAQAHAVNS 169 GD+IETGQ SASG+S Q SRKR RK S++GSV DLN+PA+AH NS Sbjct: 551 GDVIETGQASASGSSYNSLQYSRKRARKASSSSGSVFDLNMPAEAHPANS 600