BLASTX nr result
ID: Mentha26_contig00042542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042542 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus... 71 1e-10 >gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus guttatus] Length = 543 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 1 GGLTDLSQEKDKGPLPSFYMGAPMGSGSTHGKSGFTSTPLNDD 129 GGLTD S+EKDKG LPSFYMG MG+G+ GKSGFTSTPL+DD Sbjct: 484 GGLTDGSEEKDKGHLPSFYMGKAMGAGTAGGKSGFTSTPLDDD 526