BLASTX nr result
ID: Mentha26_contig00042436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042436 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142061.1| PREDICTED: hsp70-binding protein 1-like [Cuc... 57 2e-06 ref|XP_002308167.2| hypothetical protein POPTR_0006s08830g [Popu... 57 3e-06 gb|EXC14804.1| Hsp70-binding protein 1 [Morus notabilis] 57 3e-06 ref|XP_006480867.1| PREDICTED: hsp70-binding protein 1-like [Cit... 56 4e-06 ref|XP_006429133.1| hypothetical protein CICLE_v10011911mg [Citr... 56 4e-06 >ref|XP_004142061.1| PREDICTED: hsp70-binding protein 1-like [Cucumis sativus] gi|449515169|ref|XP_004164622.1| PREDICTED: hsp70-binding protein 1-like [Cucumis sativus] Length = 397 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 319 SPLFEKGLLSLPGEDDPPPDVASQFFQPPLRAW 221 S L EKGLL LPGED PPPDVAS+ F+PPLRAW Sbjct: 313 SSLREKGLLVLPGEDAPPPDVASKHFEPPLRAW 345 >ref|XP_002308167.2| hypothetical protein POPTR_0006s08830g [Populus trichocarpa] gi|550335809|gb|EEE91690.2| hypothetical protein POPTR_0006s08830g [Populus trichocarpa] Length = 395 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 319 SPLFEKGLLSLPGEDDPPPDVASQFFQPPLRAW 221 S L +KGLL LPGED PPPDVAS+ F+PPLRAW Sbjct: 313 SSLRDKGLLVLPGEDSPPPDVASKHFEPPLRAW 345 >gb|EXC14804.1| Hsp70-binding protein 1 [Morus notabilis] Length = 397 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 319 SPLFEKGLLSLPGEDDPPPDVASQFFQPPLRAW 221 S L EKGLL LPGED PPPDV S+ F+PPLRAW Sbjct: 313 SSLHEKGLLLLPGEDAPPPDVVSKHFEPPLRAW 345 >ref|XP_006480867.1| PREDICTED: hsp70-binding protein 1-like [Citrus sinensis] Length = 394 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 319 SPLFEKGLLSLPGEDDPPPDVASQFFQPPLRAW 221 S L +KGLL LPGED PPPDVAS+ F+PPLRAW Sbjct: 313 SSLRDKGLLVLPGEDAPPPDVASKHFEPPLRAW 345 >ref|XP_006429133.1| hypothetical protein CICLE_v10011911mg [Citrus clementina] gi|557531190|gb|ESR42373.1| hypothetical protein CICLE_v10011911mg [Citrus clementina] Length = 394 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 319 SPLFEKGLLSLPGEDDPPPDVASQFFQPPLRAW 221 S L +KGLL LPGED PPPDVAS+ F+PPLRAW Sbjct: 313 SSLRDKGLLVLPGEDAPPPDVASKHFEPPLRAW 345