BLASTX nr result
ID: Mentha26_contig00042433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042433 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35379.1| hypothetical protein MIMGU_mgv1a000476mg [Mimulus... 58 1e-06 gb|EYU19354.1| hypothetical protein MIMGU_mgv1a000485mg [Mimulus... 57 3e-06 gb|AGT50254.1| phytochrome A2 [Ipomoea batatas] 56 5e-06 gb|AGT50253.1| phytochrome A1 [Ipomoea batatas] 56 5e-06 ref|NP_001234490.1| alternative transcript type 3 [Solanum lycop... 56 6e-06 gb|AGT50255.1| phytochrome A3 [Ipomoea batatas] 56 6e-06 >gb|EYU35379.1| hypothetical protein MIMGU_mgv1a000476mg [Mimulus guttatus] Length = 1129 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISSNS 274 LVKLMNGDVQYLREAG+STFIIS+ELAIS+N+ Sbjct: 1098 LVKLMNGDVQYLREAGKSTFIISVELAISNNN 1129 >gb|EYU19354.1| hypothetical protein MIMGU_mgv1a000485mg [Mimulus guttatus] Length = 1125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISSNSQ 271 LVKLMNGDVQYLREAGRSTFI+++E+AISS Q Sbjct: 1092 LVKLMNGDVQYLREAGRSTFIVTVEVAISSKPQ 1124 >gb|AGT50254.1| phytochrome A2 [Ipomoea batatas] Length = 1127 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISS 280 LVKLMNGDVQYLREAGRSTFIIS+ELA++S Sbjct: 1094 LVKLMNGDVQYLREAGRSTFIISVELAVAS 1123 >gb|AGT50253.1| phytochrome A1 [Ipomoea batatas] Length = 1127 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISS 280 LVKLMNGDVQYLREAGRSTFIIS+ELA++S Sbjct: 1094 LVKLMNGDVQYLREAGRSTFIISVELAVAS 1123 >ref|NP_001234490.1| alternative transcript type 3 [Solanum lycopersicum] gi|3492795|emb|CAA05086.1| phyA [Solanum lycopersicum] gi|3492797|emb|CAA05087.1| phyA [Solanum lycopersicum] gi|3492799|emb|CAA05088.1| phyA [Solanum lycopersicum] gi|3492801|emb|CAA05089.1| phyA [Solanum lycopersicum] Length = 1123 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISSNS 274 LVKLMNG+VQYLREAG+STFIIS+ELA+++NS Sbjct: 1091 LVKLMNGEVQYLREAGQSTFIISVELAVATNS 1122 >gb|AGT50255.1| phytochrome A3 [Ipomoea batatas] Length = 1127 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 369 LVKLMNGDVQYLREAGRSTFIISLELAISS 280 LVKLMNGD+QYLREAGRSTFIIS+ELA++S Sbjct: 1094 LVKLMNGDIQYLREAGRSTFIISVELAVAS 1123