BLASTX nr result
ID: Mentha26_contig00042292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042292 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38766.1| hypothetical protein MIMGU_mgv1a004145mg [Mimulus... 98 1e-18 gb|EPS59695.1| hypothetical protein M569_15110, partial [Genlise... 94 2e-17 ref|XP_007014328.1| F11A6.3 protein, putative isoform 1 [Theobro... 78 1e-12 ref|XP_006482970.1| PREDICTED: digestive organ expansion factor ... 78 1e-12 ref|XP_006438898.1| hypothetical protein CICLE_v10030781mg [Citr... 78 1e-12 ref|XP_003533727.1| PREDICTED: U3 small nucleolar RNA-associated... 78 1e-12 ref|XP_002267174.1| PREDICTED: digestive organ expansion factor ... 76 4e-12 emb|CAN69195.1| hypothetical protein VITISV_006520 [Vitis vinifera] 76 4e-12 ref|XP_006598382.1| PREDICTED: U3 small nucleolar RNA-associated... 76 6e-12 ref|XP_002442789.1| hypothetical protein SORBIDRAFT_08g002830 [S... 76 6e-12 gb|AFW56007.1| hypothetical protein ZEAMMB73_164754 [Zea mays] 75 1e-11 ref|XP_006389560.1| hypothetical protein POPTR_0022s00850g [Popu... 75 1e-11 ref|XP_006389558.1| hypothetical protein POPTR_0022s00850g [Popu... 75 1e-11 ref|XP_004161801.1| PREDICTED: U3 small nucleolar RNA-associated... 75 1e-11 ref|XP_004955368.1| PREDICTED: digestive organ expansion factor ... 74 2e-11 ref|XP_004955365.1| PREDICTED: digestive organ expansion factor ... 74 2e-11 ref|XP_007138796.1| hypothetical protein PHAVU_009G238100g [Phas... 74 2e-11 gb|EEC78915.1| hypothetical protein OsI_19328 [Oryza sativa Indi... 73 4e-11 ref|NP_001055109.1| Os05g0295100 [Oryza sativa Japonica Group] g... 73 4e-11 ref|XP_006655241.1| PREDICTED: U3 small nucleolar RNA-associated... 72 6e-11 >gb|EYU38766.1| hypothetical protein MIMGU_mgv1a004145mg [Mimulus guttatus] Length = 542 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVFA 161 EFYPEIVN LEESD+MNC VLFSRLDHLRLERIVGS AAKRM+DS+KGVFVFA Sbjct: 490 EFYPEIVNFLEESDNMNCTVLFSRLDHLRLERIVGSTAAKRMVDSEKGVFVFA 542 >gb|EPS59695.1| hypothetical protein M569_15110, partial [Genlisea aurea] Length = 191 Score = 94.4 bits (233), Expect = 2e-17 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVFA 161 EFYPEIVN LEES+SM+CRVLFS LDH R+ERIVGS+AAKRM+DSDKGVFVFA Sbjct: 139 EFYPEIVNFLEESESMSCRVLFSPLDHFRVERIVGSSAAKRMLDSDKGVFVFA 191 >ref|XP_007014328.1| F11A6.3 protein, putative isoform 1 [Theobroma cacao] gi|508784691|gb|EOY31947.1| F11A6.3 protein, putative isoform 1 [Theobroma cacao] Length = 736 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+LE SD M C +LFS D LRLERIVGS AKRMI S+KGVFVF Sbjct: 684 EFYPEIVNMLEGSDDMACTILFSLFDKLRLERIVGSAPAKRMIKSEKGVFVF 735 >ref|XP_006482970.1| PREDICTED: digestive organ expansion factor homolog [Citrus sinensis] Length = 754 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+LE S +M C VLFSR D LRLERIVGS AK+M+ S+KGVFVF Sbjct: 702 EFYPEIVNMLEGSHNMTCTVLFSRFDMLRLERIVGSAPAKKMVKSEKGVFVF 753 >ref|XP_006438898.1| hypothetical protein CICLE_v10030781mg [Citrus clementina] gi|557541094|gb|ESR52138.1| hypothetical protein CICLE_v10030781mg [Citrus clementina] Length = 754 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+LE S +M C VLFSR D LRLERIVGS AK+M+ S+KGVFVF Sbjct: 702 EFYPEIVNMLEGSHNMTCTVLFSRFDMLRLERIVGSAPAKKMVKSEKGVFVF 753 >ref|XP_003533727.1| PREDICTED: U3 small nucleolar RNA-associated protein 25-like [Glycine max] Length = 675 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+L+ SD+M C VLFS LD LRLERIVG+ AKRM+ ++KGVFVF Sbjct: 622 EFYPEIVNMLDGSDNMTCTVLFSYLDKLRLERIVGTTPAKRMVAAEKGVFVF 673 >ref|XP_002267174.1| PREDICTED: digestive organ expansion factor homolog [Vitis vinifera] gi|296090307|emb|CBI40126.3| unnamed protein product [Vitis vinifera] Length = 753 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+LE S +M C VLFSR D RLERIVGS AKRM+ S+K VFVF Sbjct: 701 EFYPEIVNMLEGSHNMTCTVLFSRFDQFRLERIVGSGPAKRMVASEKNVFVF 752 >emb|CAN69195.1| hypothetical protein VITISV_006520 [Vitis vinifera] Length = 401 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+LE S +M C VLFSR D RLERIVGS AKRM+ S+K VFVF Sbjct: 349 EFYPEIVNMLEGSHNMTCTVLFSRFDQFRLERIVGSGPAKRMVASEKNVFVF 400 >ref|XP_006598382.1| PREDICTED: U3 small nucleolar RNA-associated protein 25-like [Glycine max] Length = 680 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+L+ SD+M C LFS LD LRLERIVG+ AKRM+ ++KGVFVF Sbjct: 627 EFYPEIVNMLDGSDNMTCTALFSYLDKLRLERIVGTTPAKRMVVAEKGVFVF 678 >ref|XP_002442789.1| hypothetical protein SORBIDRAFT_08g002830 [Sorghum bicolor] gi|241943482|gb|EES16627.1| hypothetical protein SORBIDRAFT_08g002830 [Sorghum bicolor] Length = 444 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES+ C VLFSRLD L+LERIVG+++A+R+I SDKG+FVF Sbjct: 392 EFYPELVNMLGESEIRKCNVLFSRLDLLKLERIVGTSSARRLISSDKGMFVF 443 >gb|AFW56007.1| hypothetical protein ZEAMMB73_164754 [Zea mays] Length = 654 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/52 (65%), Positives = 45/52 (86%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES++ C VLFSRLD L+LERIVG ++A+R+I S+KG+FVF Sbjct: 602 EFYPELVNMLGESENRKCNVLFSRLDLLKLERIVGKSSARRLISSEKGMFVF 653 >ref|XP_006389560.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] gi|550312383|gb|ERP48474.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] Length = 687 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EF+PE+VN+LE +D M C VLFS+ D L+LERIVG+ +A+RMI S+KGVFVF Sbjct: 635 EFFPEVVNMLEGADDMTCTVLFSQFDQLQLERIVGTASARRMITSEKGVFVF 686 >ref|XP_006389558.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] gi|566260010|ref|XP_006389559.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] gi|550312381|gb|ERP48472.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] gi|550312382|gb|ERP48473.1| hypothetical protein POPTR_0022s00850g [Populus trichocarpa] Length = 686 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EF+PE+VN+LE +D M C VLFS+ D L+LERIVG+ +A+RMI S+KGVFVF Sbjct: 634 EFFPEVVNMLEGADDMTCTVLFSQFDQLQLERIVGTASARRMITSEKGVFVF 685 >ref|XP_004161801.1| PREDICTED: U3 small nucleolar RNA-associated protein 25-like [Cucumis sativus] Length = 710 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+L+ES SM CRVLFS D LRLERIVG+ AK+M S+K VF+F Sbjct: 658 EFYPEIVNMLDESQSMTCRVLFSPFDQLRLERIVGTVPAKKMTTSEKKVFIF 709 >ref|XP_004955368.1| PREDICTED: digestive organ expansion factor homolog isoform X4 [Setaria italica] Length = 652 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/52 (65%), Positives = 45/52 (86%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES++ C VLFSRLD L+LERIVG+++A+R+I SDK +FVF Sbjct: 600 EFYPELVNMLGESENPKCNVLFSRLDLLKLERIVGTSSARRLISSDKSMFVF 651 >ref|XP_004955365.1| PREDICTED: digestive organ expansion factor homolog isoform X1 [Setaria italica] gi|514723931|ref|XP_004955366.1| PREDICTED: digestive organ expansion factor homolog isoform X2 [Setaria italica] gi|514723935|ref|XP_004955367.1| PREDICTED: digestive organ expansion factor homolog isoform X3 [Setaria italica] Length = 652 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/52 (65%), Positives = 45/52 (86%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES++ C VLFSRLD L+LERIVG+++A+R+I SDK +FVF Sbjct: 600 EFYPELVNMLGESENPKCNVLFSRLDLLKLERIVGTSSARRLISSDKSMFVF 651 >ref|XP_007138796.1| hypothetical protein PHAVU_009G238100g [Phaseolus vulgaris] gi|561011883|gb|ESW10790.1| hypothetical protein PHAVU_009G238100g [Phaseolus vulgaris] Length = 666 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPEIVN+L S++M C VLFS LD LRLERIVG+ AKRM+ ++KGVFVF Sbjct: 613 EFYPEIVNMLNGSNNMTCTVLFSCLDKLRLERIVGTTPAKRMMAAEKGVFVF 664 >gb|EEC78915.1| hypothetical protein OsI_19328 [Oryza sativa Indica Group] gi|222630989|gb|EEE63121.1| hypothetical protein OsJ_17929 [Oryza sativa Japonica Group] Length = 565 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES++ C V FSRLD L+LERIVG+ AA+R++ SDK +FVF Sbjct: 513 EFYPELVNMLSESENRKCTVFFSRLDLLKLERIVGTFAAQRLVSSDKSIFVF 564 >ref|NP_001055109.1| Os05g0295100 [Oryza sativa Japonica Group] gi|113578660|dbj|BAF17023.1| Os05g0295100 [Oryza sativa Japonica Group] Length = 664 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES++ C V FSRLD L+LERIVG+ AA+R++ SDK +FVF Sbjct: 612 EFYPELVNMLSESENRKCTVFFSRLDLLKLERIVGTFAAQRLVSSDKSIFVF 663 >ref|XP_006655241.1| PREDICTED: U3 small nucleolar RNA-associated protein 25-like [Oryza brachyantha] Length = 707 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +3 Query: 3 EFYPEIVNLLEESDSMNCRVLFSRLDHLRLERIVGSNAAKRMIDSDKGVFVF 158 EFYPE+VN+L ES+ C V FSRLD L+LERIVG+++A+R++ SDK VFVF Sbjct: 655 EFYPELVNMLGESEHRKCTVFFSRLDLLKLERIVGTSSAQRLVSSDKSVFVF 706