BLASTX nr result
ID: Mentha26_contig00042272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042272 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18398.1| hypothetical protein MIMGU_mgv1a005858mg [Mimulus... 57 3e-06 >gb|EYU18398.1| hypothetical protein MIMGU_mgv1a005858mg [Mimulus guttatus] Length = 467 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -3 Query: 327 KKEWRCDLCKVMATSKKNLHAHLRGSKHKSNLEVETLKASMLGAKHTGFSLSGT 166 ++EW C LC+V TS+K L+ HLRGSKHKSN E LK S L AK TG ++S T Sbjct: 313 QQEWICGLCQVATTSEKTLNEHLRGSKHKSN--CENLK-SKLNAKETGPAISPT 363