BLASTX nr result
ID: Mentha26_contig00042229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042229 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41491.1| hypothetical protein MIMGU_mgv1a001686mg [Mimulus... 74 3e-11 gb|EYU45652.1| hypothetical protein MIMGU_mgv1a000359mg [Mimulus... 68 1e-09 >gb|EYU41491.1| hypothetical protein MIMGU_mgv1a001686mg [Mimulus guttatus] Length = 773 Score = 73.6 bits (179), Expect = 3e-11 Identities = 46/94 (48%), Positives = 58/94 (61%), Gaps = 1/94 (1%) Frame = +3 Query: 3 LVGKERSAEKDKGEMKLEKGNPISNKKRKGKDSGDVETDTVLKLATP-RRQASSKKAVKK 179 L+ KE++ EK K E+KLEK P +K K DS TDT LKLA P R SSKK VK Sbjct: 56 LLDKEKTIEKKKIEVKLEKVKPGLSKGIKAIDSESDGTDTALKLAPPGLRVCSSKKVVKM 115 Query: 180 GVDKSQSSEISTPVKGKEGKEGNLKCGGSTEKQM 281 +++ S ++ VK K+ KEG K GGSTEKQ+ Sbjct: 116 EEERAPSENVTPVVKVKDEKEGKAKRGGSTEKQI 149 >gb|EYU45652.1| hypothetical protein MIMGU_mgv1a000359mg [Mimulus guttatus] Length = 1219 Score = 67.8 bits (164), Expect = 1e-09 Identities = 45/93 (48%), Positives = 60/93 (64%), Gaps = 1/93 (1%) Frame = +3 Query: 6 VGKERSAEKDKGEM-KLEKGNPISNKKRKGKDSGDVETDTVLKLATPRRQASSKKAVKKG 182 V KE+S +K++ E KLE P+ +K +K +DS +VETDT LKL PR K +KK Sbjct: 213 VDKEKSVDKEEKEKTKLETVKPLLSKGKKARDS-EVETDTELKLTQPR------KGMKKE 265 Query: 183 VDKSQSSEISTPVKGKEGKEGNLKCGGSTEKQM 281 + S + E STP +GKEGK +K GG+TEKQM Sbjct: 266 EEGSFARENSTPCEGKEGK---VKRGGTTEKQM 295