BLASTX nr result
ID: Mentha26_contig00042056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00042056 (624 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21249.1| hypothetical protein MIMGU_mgv1a008830mg [Mimulus... 70 7e-10 gb|EYU45926.1| hypothetical protein MIMGU_mgv1a009265mg [Mimulus... 61 2e-07 gb|AAS21305.1| mitogen-activated protein kinase kinase 5 [Petros... 57 5e-06 >gb|EYU21249.1| hypothetical protein MIMGU_mgv1a008830mg [Mimulus guttatus] Length = 361 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/62 (53%), Positives = 45/62 (72%), Gaps = 5/62 (8%) Frame = -1 Query: 462 NFISCCLQGKPARRLSTAQLLKVPLIVQYSSPGSGGS-----NMVHHQAHQLLPPSRQQY 298 +FI+CCLQ +PA+R + QLL+ P I+QY SPGS GS N + HQ+HQLLPP +Q+ Sbjct: 300 DFIACCLQREPAKRWTAGQLLRHPFILQYVSPGSNGSGGSGGNSLQHQSHQLLPPPPRQH 359 Query: 297 SS 292 S+ Sbjct: 360 SA 361 >gb|EYU45926.1| hypothetical protein MIMGU_mgv1a009265mg [Mimulus guttatus] Length = 348 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -1 Query: 462 NFISCCLQGKPARRLSTAQLLKVPLIVQYSSPGSGGSNMVHHQAHQLLPPSRQQYSSA 289 +FI+CCLQ P++R + +QLLK P I + +P + GSN V HQ+HQLLPP+R +SSA Sbjct: 293 DFIACCLQRDPSKRWTASQLLKHPFITLH-APQARGSNQV-HQSHQLLPPARPHFSSA 348 >gb|AAS21305.1| mitogen-activated protein kinase kinase 5 [Petroselinum crispum] Length = 356 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 4/61 (6%) Frame = -1 Query: 459 FISCCLQGKPARRLSTAQLLKVPLIVQYSS----PGSGGSNMVHHQAHQLLPPSRQQYSS 292 FISCCLQ P RR + QLL+ P +VQ ++ GSGG + V +QAHQLLPP R SS Sbjct: 297 FISCCLQRDPHRRWTANQLLRHPFVVQTNNGTPPNGSGGGSQV-NQAHQLLPPPRPHPSS 355 Query: 291 A 289 A Sbjct: 356 A 356