BLASTX nr result
ID: Mentha26_contig00041960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041960 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18635.1| hypothetical protein MIMGU_mgv1a000142mg [Mimulus... 69 9e-10 >gb|EYU18635.1| hypothetical protein MIMGU_mgv1a000142mg [Mimulus guttatus] Length = 1631 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/53 (69%), Positives = 41/53 (77%), Gaps = 5/53 (9%) Frame = -3 Query: 145 MSLHSAGQVVQSVKLFS---ITDNCRKDLVFVDFVGLCGSKNLKKN--GGRRR 2 MSLHSA VVQSVKLF+ I D+C+KDLVFVDFVGLC K KK+ GGRRR Sbjct: 1 MSLHSASHVVQSVKLFAGNPINDSCKKDLVFVDFVGLCAGKKSKKSSGGGRRR 53