BLASTX nr result
ID: Mentha26_contig00041774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041774 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238907.1| PREDICTED: probable protein phosphatase 2C 1... 72 8e-11 ref|XP_006344157.1| PREDICTED: probable protein phosphatase 2C 1... 72 1e-10 ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citr... 67 3e-09 ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 1... 67 3e-09 ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cac... 64 2e-08 ref|XP_007222389.1| hypothetical protein PRUPE_ppa006061mg [Prun... 64 2e-08 gb|EPS73050.1| hypothetical protein M569_01706, partial [Genlise... 63 5e-08 ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 1... 63 5e-08 gb|EXB77531.1| putative protein phosphatase 2C 15 [Morus notabilis] 62 1e-07 gb|EYU30003.1| hypothetical protein MIMGU_mgv1a006840mg [Mimulus... 61 2e-07 ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phas... 61 2e-07 ref|XP_003592620.1| hypothetical protein MTR_1g110210 [Medicago ... 60 3e-07 ref|XP_002279675.1| PREDICTED: probable protein phosphatase 2C 1... 60 4e-07 emb|CAN76446.1| hypothetical protein VITISV_010117 [Vitis vinifera] 60 4e-07 ref|XP_003555914.1| PREDICTED: probable protein phosphatase 2C 1... 59 5e-07 ref|XP_003536672.1| PREDICTED: probable protein phosphatase 2C 1... 59 5e-07 ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 1... 59 7e-07 ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arab... 58 2e-06 ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Popu... 55 8e-06 ref|XP_002527010.1| protein phosphatase, putative [Ricinus commu... 55 8e-06 >ref|XP_004238907.1| PREDICTED: probable protein phosphatase 2C 15-like [Solanum lycopersicum] Length = 429 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 MGSR+E S HDLVPLA LI+RELRNEKMEKP VRYG AAQS+K Sbjct: 1 MGSRQERHRSDHDLVPLAALISRELRNEKMEKPTVRYGCAAQSKK 45 >ref|XP_006344157.1| PREDICTED: probable protein phosphatase 2C 15-like [Solanum tuberosum] Length = 429 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 MGSREE +HDLVPLA LI+RELRNEKMEKP VRYG AAQS+K Sbjct: 1 MGSREERHRLNHDLVPLAALISRELRNEKMEKPTVRYGCAAQSKK 45 >ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citrus clementina] gi|567912211|ref|XP_006448419.1| hypothetical protein CICLE_v10015330mg [Citrus clementina] gi|568828831|ref|XP_006468741.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 [Citrus sinensis] gi|568828833|ref|XP_006468742.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 [Citrus sinensis] gi|557551029|gb|ESR61658.1| hypothetical protein CICLE_v10015330mg [Citrus clementina] gi|557551030|gb|ESR61659.1| hypothetical protein CICLE_v10015330mg [Citrus clementina] Length = 428 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M SRE RH HHDLVPLA LI+RE+RNEKMEKP V +G AAQSRK Sbjct: 1 MASREGRRH-HHDLVPLAALISREMRNEKMEKPNVSFGQAAQSRK 44 >ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 15-like [Fragaria vesca subsp. vesca] Length = 429 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 MGS E R+ HH+LVPLA LI+REL+NEKMEKP VRYG AAQSRK Sbjct: 1 MGSTEGSRN-HHNLVPLAALISRELKNEKMEKPTVRYGHAAQSRK 44 >ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cacao] gi|508708188|gb|EOY00085.1| Phosphatase 2C family protein [Theobroma cacao] Length = 428 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M S E RH HDLVPLA LI+RE++NEKMEKP VRYG AAQSRK Sbjct: 1 MASGEGRRH-RHDLVPLAALISREMKNEKMEKPTVRYGHAAQSRK 44 >ref|XP_007222389.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica] gi|462419325|gb|EMJ23588.1| hypothetical protein PRUPE_ppa006061mg [Prunus persica] Length = 429 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M S E RH HH+LVPLA LI+REL++EKMEKP VRYG AAQSRK Sbjct: 1 MASGEGRRH-HHNLVPLAALISRELKSEKMEKPTVRYGHAAQSRK 44 >gb|EPS73050.1| hypothetical protein M569_01706, partial [Genlisea aurea] Length = 436 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 142 LVMGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 ++MGSR E DLVPLA LI+RE +N+K+EKP VRYGSAAQSRK Sbjct: 2 ILMGSRGERHVIRGDLVPLAALISREFKNDKLEKPTVRYGSAAQSRK 48 >ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus] gi|449493442|ref|XP_004159290.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus] Length = 433 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/48 (64%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = -3 Query: 136 MGSREEDRHS---HHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M SRE RH HH+LVPLA LI++E+R+E++EKP VRYG+AAQSRK Sbjct: 1 MASREGRRHHNHRHHNLVPLAALISKEVRSERLEKPTVRYGNAAQSRK 48 >gb|EXB77531.1| putative protein phosphatase 2C 15 [Morus notabilis] Length = 526 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -3 Query: 136 MGSREEDRHSHH--DLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M SRE RH HH +LVPLA LI+RE+++EKMEKP VR G AAQSRK Sbjct: 1 MASREGKRHHHHHHNLVPLAALISREMKSEKMEKPTVRCGYAAQSRK 47 >gb|EYU30003.1| hypothetical protein MIMGU_mgv1a006840mg [Mimulus guttatus] gi|604318512|gb|EYU30004.1| hypothetical protein MIMGU_mgv1a006840mg [Mimulus guttatus] Length = 429 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 MGSREE + DLVPLA LI+REL+ EKMEK ++R GSAAQSRK Sbjct: 1 MGSREERHRHNQDLVPLAALISRELKMEKMEKTSLRIGSAAQSRK 45 >ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris] gi|561016133|gb|ESW14937.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris] Length = 431 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 121 EDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 E R HHDLVPLA L+ RE+++EKMEKP VR+G AAQS+K Sbjct: 5 EGRRRHHDLVPLAALLKREMKSEKMEKPTVRFGHAAQSKK 44 >ref|XP_003592620.1| hypothetical protein MTR_1g110210 [Medicago truncatula] gi|355481668|gb|AES62871.1| hypothetical protein MTR_1g110210 [Medicago truncatula] Length = 327 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M S E RH HHDLVPLA L+ RE+++EKMEKP VR G AAQS+K Sbjct: 1 MASGEGRRH-HHDLVPLAALLKREMKSEKMEKPTVRIGQAAQSKK 44 >ref|XP_002279675.1| PREDICTED: probable protein phosphatase 2C 15 [Vitis vinifera] gi|297737782|emb|CBI26983.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 106 HHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 H +LVPLA LINRE+R+EKMEKP VRYG AAQSRK Sbjct: 9 HRNLVPLAALINREMRSEKMEKPTVRYGCAAQSRK 43 >emb|CAN76446.1| hypothetical protein VITISV_010117 [Vitis vinifera] Length = 1001 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 106 HHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 H +LVPLA LINRE+R+EKMEKP VRYG AAQSRK Sbjct: 9 HRNLVPLAALINREMRSEKMEKPTVRYGCAAQSRK 43 >ref|XP_003555914.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 [Glycine max] gi|571566478|ref|XP_006605919.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 [Glycine max] gi|571566482|ref|XP_006605920.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 [Glycine max] Length = 431 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 121 EDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 E R HHDLVPLA L+ RE+++EKMEKP VR G AAQS+K Sbjct: 5 EGRRRHHDLVPLAALLKREMKSEKMEKPTVRVGHAAQSKK 44 >ref|XP_003536672.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 [Glycine max] gi|571484875|ref|XP_006589677.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 [Glycine max] gi|571484877|ref|XP_006589678.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 [Glycine max] gi|571484879|ref|XP_006589679.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X4 [Glycine max] Length = 431 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 121 EDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 E R HHDLVPLA L+ RE+++EKMEKP VR G AAQS+K Sbjct: 5 EGRRRHHDLVPLAALLKREMKSEKMEKPTVRVGHAAQSKK 44 >ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 [Cicer arietinum] gi|502120734|ref|XP_004497063.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 [Cicer arietinum] gi|502120736|ref|XP_004497064.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 [Cicer arietinum] Length = 429 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 136 MGSREEDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 M S E +H H DLVPLA L+ RE+++EKMEKP VR G AAQS+K Sbjct: 1 MASGEGRQHHHRDLVPLAALLKREMKSEKMEKPNVRIGQAAQSKK 45 >ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. lyrata] gi|297334503|gb|EFH64921.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -3 Query: 133 GSREEDRHSHHD--LVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 G R H+HHD LVPLA LI+RE + KMEKP VR+G AAQSRK Sbjct: 6 GKRRNHHHNHHDEKLVPLAALISRETKAAKMEKPIVRFGQAAQSRK 51 >ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa] gi|550329701|gb|ERP56267.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa] Length = 428 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 121 EDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 E+R +LVPLA LI+RE+R EKMEKP V+YG AAQSRK Sbjct: 5 EERRRRDNLVPLAALISREMRIEKMEKPIVKYGHAAQSRK 44 >ref|XP_002527010.1| protein phosphatase, putative [Ricinus communis] gi|223533645|gb|EEF35382.1| protein phosphatase, putative [Ricinus communis] Length = 428 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 121 EDRHSHHDLVPLAQLINRELRNEKMEKPAVRYGSAAQSRK 2 E R +LVPLA LI+RE++NEKMEKP VR GSAAQSRK Sbjct: 5 EGRCRRDNLVPLAALISREMKNEKMEKPTVRCGSAAQSRK 44