BLASTX nr result
ID: Mentha26_contig00041510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041510 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37956.1| hypothetical protein MIMGU_mgv1a005510mg [Mimulus... 75 9e-12 >gb|EYU37956.1| hypothetical protein MIMGU_mgv1a005510mg [Mimulus guttatus] Length = 481 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 IIFPIVRSEGVRQMFFPITISAYNRGTSVVMKSAMFDMMA 120 IIFPIV+SEGVRQMFFPITI AYN+G+SVVMKSAMFDMMA Sbjct: 442 IIFPIVKSEGVRQMFFPITIPAYNKGSSVVMKSAMFDMMA 481