BLASTX nr result
ID: Mentha26_contig00041306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041306 (1126 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 89 3e-15 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 89.0 bits (219), Expect = 3e-15 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = +2 Query: 2 VAGIEPASLAWKARGYSRRRFSALNVSNSKPNVKLWFHSAPLWK 133 VAGIEPASLAWKA+GYSRRRFS+L+VSNSKPN+KLWFHSAPLW+ Sbjct: 14 VAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57