BLASTX nr result
ID: Mentha26_contig00041256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041256 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521425.1| Nuclease PA3, putative [Ricinus communis] gi... 56 5e-06 >ref|XP_002521425.1| Nuclease PA3, putative [Ricinus communis] gi|223539324|gb|EEF40915.1| Nuclease PA3, putative [Ricinus communis] Length = 298 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 466 YFYSRWPIVESRLAQGGVRLAALLNRIFSDQKSIADE 356 YF SR PIVE RLAQGG+RLAA LNRIFS Q IA E Sbjct: 262 YFLSRLPIVEKRLAQGGIRLAATLNRIFSPQSKIAQE 298