BLASTX nr result
ID: Mentha26_contig00041114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041114 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG17072.1| GID1A [Vitis vinifera] 72 8e-11 emb|CBI34320.3| unnamed protein product [Vitis vinifera] 72 8e-11 emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] 72 8e-11 emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] 72 8e-11 gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|5117... 72 1e-10 ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prun... 72 1e-10 gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] 72 1e-10 gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] 71 1e-10 gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus... 70 2e-10 ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [... 70 2e-10 gb|AFD32892.1| GID1c [Malus domestica] 70 2e-10 ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Popu... 70 2e-10 gb|EXC34655.1| Gibberellin receptor GID1B [Morus notabilis] 70 3e-10 ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [... 70 3e-10 gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] 70 3e-10 gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] 70 3e-10 ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like i... 70 3e-10 ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus... 69 5e-10 ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citr... 69 7e-10 gb|AGU38487.1| GID1b [Camellia sinensis] 69 7e-10 >gb|AFG17072.1| GID1A [Vitis vinifera] Length = 344 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >emb|CBI34320.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] Length = 435 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 368 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 403 >emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] Length = 344 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|511782930|gb|AGN95007.1| gibberellin receptor 1b [Prunus salicina] Length = 344 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVNV+ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|595793197|ref|XP_007200347.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395746|gb|EMJ01545.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395747|gb|EMJ01546.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] Length = 344 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVNV+ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] Length = 346 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+NV+ESK+VVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGSNEINVNESKKVVPLNTWILISNFKLAYNMLRR 36 >gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] Length = 345 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+N +ESKRVVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLAYNMLRR 36 >gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus guttatus] Length = 344 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN +ESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNANESKRVVPLNTWILISNFKLAYNLLRR 36 >ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [Fragaria vesca subsp. vesca] Length = 344 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN++ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|AFD32892.1| GID1c [Malus domestica] Length = 346 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVNV+ESK+VVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKKVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] gi|222844539|gb|EEE82086.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] Length = 344 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNEVN++ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|EXC34655.1| Gibberellin receptor GID1B [Morus notabilis] Length = 345 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAG NEVN+SESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGDNEVNLSESKRVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [Solanum tuberosum] Length = 345 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] Length = 346 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAG+NE+N++ESK+VVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGNNEININESKKVVPLNTWILISNFKLAYNMLRR 36 >gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] Length = 345 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like isoform 1 [Solanum lycopersicum] Length = 345 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223535951|gb|EEF37610.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 345 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAG+NEVN++ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGTNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] gi|568852325|ref|XP_006479828.1| PREDICTED: gibberellin receptor GID1B-like [Citrus sinensis] gi|557546449|gb|ESR57427.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] Length = 344 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAG NEVN++ESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGGNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|AGU38487.1| GID1b [Camellia sinensis] Length = 345 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 231 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRR 338 MAGSNE+N +ESKRVVPLNTWILISN KLAYNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNLKLAYNMLRR 36