BLASTX nr result
ID: Mentha26_contig00041040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041040 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633804.1| PREDICTED: RING-H2 finger protein ATL46-like... 56 5e-06 ref|XP_007031414.1| RING/U-box superfamily protein isoform 3, pa... 56 6e-06 ref|XP_007031412.1| RING/U-box superfamily protein isoform 1 [Th... 56 6e-06 >ref|XP_003633804.1| PREDICTED: RING-H2 finger protein ATL46-like [Vitis vinifera] Length = 397 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/77 (45%), Positives = 42/77 (54%) Frame = +1 Query: 265 FVCGNLDVVCPKREMQGQRWISGQIAPTHLKMSWIKYQINEKDSVLANPPPFVLAPPSSY 444 F C + VC E + RW G THLKMSWI++QI +KD L PPP L P SS Sbjct: 3 FECSQM--VCSMSERE-HRWFFGH---THLKMSWIQHQIKQKDGYLTYPPP--LTPSSSS 54 Query: 445 VDGSNFHRESPPPPSSS 495 + FH+ S P SSS Sbjct: 55 PYTAAFHKGSTAPSSSS 71 >ref|XP_007031414.1| RING/U-box superfamily protein isoform 3, partial [Theobroma cacao] gi|508710443|gb|EOY02340.1| RING/U-box superfamily protein isoform 3, partial [Theobroma cacao] Length = 379 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 286 VVCPKREMQGQRWISGQIAPTHLKMSWIKY-QINEKDSVLANPPPFVLAPPSSYVDGSNF 462 ++C E++ + W+ + HLKMSW+ + QI +KD PPP PPS Y + F Sbjct: 8 IICGMLEIKEKSWV---LEHNHLKMSWVHHNQIRQKDGYFQYPPPL---PPSPYTAATTF 61 Query: 463 HRESPPPPSSS 495 H++S P PSS+ Sbjct: 62 HKDSNPSPSST 72 >ref|XP_007031412.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|590645686|ref|XP_007031413.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508710441|gb|EOY02338.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508710442|gb|EOY02339.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] Length = 400 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 286 VVCPKREMQGQRWISGQIAPTHLKMSWIKY-QINEKDSVLANPPPFVLAPPSSYVDGSNF 462 ++C E++ + W+ + HLKMSW+ + QI +KD PPP PPS Y + F Sbjct: 8 IICGMLEIKEKSWV---LEHNHLKMSWVHHNQIRQKDGYFQYPPPL---PPSPYTAATTF 61 Query: 463 HRESPPPPSSS 495 H++S P PSS+ Sbjct: 62 HKDSNPSPSST 72