BLASTX nr result
ID: Mentha26_contig00040902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040902 (454 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36795.1| hypothetical protein MIMGU_mgv1a000987mg [Mimulus... 60 2e-07 ref|XP_002510555.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_002300698.1| hypothetical protein POPTR_0002s02150g [Popu... 56 6e-06 gb|EYU38792.1| hypothetical protein MIMGU_mgv1a020430mg, partial... 55 8e-06 ref|XP_006581159.1| PREDICTED: dentin sialophosphoprotein-like i... 55 1e-05 ref|XP_007135995.1| hypothetical protein PHAVU_009G009400g [Phas... 55 1e-05 >gb|EYU36795.1| hypothetical protein MIMGU_mgv1a000987mg [Mimulus guttatus] Length = 922 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKE 6 MTLDDFFTLTEMNNGLA PSRV+ELVAVM+K+ Sbjct: 1 MTLDDFFTLTEMNNGLAVPSRVKELVAVMQKD 32 >ref|XP_002510555.1| conserved hypothetical protein [Ricinus communis] gi|223551256|gb|EEF52742.1| conserved hypothetical protein [Ricinus communis] Length = 1005 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKER 3 MTL+DFFTLTEM +GL APSRV ELVAVM+KE+ Sbjct: 1 MTLEDFFTLTEMKDGLTAPSRVHELVAVMQKEK 33 >ref|XP_002300698.1| hypothetical protein POPTR_0002s02150g [Populus trichocarpa] gi|222842424|gb|EEE79971.1| hypothetical protein POPTR_0002s02150g [Populus trichocarpa] Length = 1011 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKER 3 MTL+DFFTLTEM +GL APSRV ELVAVM+KE+ Sbjct: 1 MTLEDFFTLTEMKDGLTAPSRVHELVAVMQKEK 33 >gb|EYU38792.1| hypothetical protein MIMGU_mgv1a020430mg, partial [Mimulus guttatus] Length = 850 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKER 3 M LDDFFT TEMNNGL AP RVRE +AVM+KER Sbjct: 1 MNLDDFFTSTEMNNGLVAPYRVREFMAVMQKER 33 >ref|XP_006581159.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine max] gi|571458568|ref|XP_006581160.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine max] Length = 1002 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKER 3 MTL+DFFTLTEM +GL APSRV+ELV+VM+KE+ Sbjct: 1 MTLEDFFTLTEMKDGLTAPSRVQELVSVMQKEK 33 >ref|XP_007135995.1| hypothetical protein PHAVU_009G009400g [Phaseolus vulgaris] gi|561009082|gb|ESW07989.1| hypothetical protein PHAVU_009G009400g [Phaseolus vulgaris] Length = 990 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 101 MTLDDFFTLTEMNNGLAAPSRVRELVAVMEKER 3 MTL+DFFTLTEM +GL APSRV+ELV+VM+KE+ Sbjct: 1 MTLEDFFTLTEMKDGLTAPSRVQELVSVMQKEK 33