BLASTX nr result
ID: Mentha26_contig00040894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040894 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37462.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002263624.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 gb|EXB75450.1| hypothetical protein L484_002672 [Morus notabilis] 61 1e-07 emb|CAN70810.1| hypothetical protein VITISV_034914 [Vitis vinifera] 61 2e-07 ref|XP_007010121.1| Pentatricopeptide repeat (PPR) superfamily p... 59 7e-07 ref|XP_006354902.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_004238168.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|EYU36731.1| hypothetical protein MIMGU_mgv1a006088mg [Mimulus... 56 6e-06 ref|XP_006599726.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004162522.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 55 8e-06 ref|XP_004138939.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >emb|CBI37462.3| unnamed protein product [Vitis vinifera] Length = 673 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYNPAMARRFALNQKR+SMSLRGK Sbjct: 644 SEHMRKFYNPAMARRFALNQKRRSMSLRGK 673 >ref|XP_002263624.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Vitis vinifera] Length = 709 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYNPAMARRFALNQKR+SMSLRGK Sbjct: 680 SEHMRKFYNPAMARRFALNQKRRSMSLRGK 709 >gb|EXB75450.1| hypothetical protein L484_002672 [Morus notabilis] Length = 569 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYNPAMARRFALN+KRKSMS RGK Sbjct: 540 SEHMRKFYNPAMARRFALNEKRKSMSFRGK 569 >emb|CAN70810.1| hypothetical protein VITISV_034914 [Vitis vinifera] Length = 708 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRG 87 SEHMRKFYNPAMARRFALNQKR+SMSLRG Sbjct: 653 SEHMRKFYNPAMARRFALNQKRRSMSLRG 681 >ref|XP_007010121.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508727034|gb|EOY18931.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 533 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 S+HMRKFYNPAMARRFAL+QKRKSM LRGK Sbjct: 504 SDHMRKFYNPAMARRFALHQKRKSMRLRGK 533 >ref|XP_006354902.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Solanum tuberosum] Length = 573 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMR FYNPAMARRFA+NQKR+SM+LRGK Sbjct: 544 SEHMRTFYNPAMARRFAINQKRQSMNLRGK 573 >ref|XP_004238168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Solanum lycopersicum] Length = 457 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMR FYNPAMARRFA+NQ++KSM LRGK Sbjct: 428 SEHMRTFYNPAMARRFAINQRQKSMKLRGK 457 >gb|EYU36731.1| hypothetical protein MIMGU_mgv1a006088mg [Mimulus guttatus] Length = 458 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRK YNPAMARR+AL+QKRKSMSLR K Sbjct: 429 SEHMRKLYNPAMARRYALSQKRKSMSLRDK 458 >ref|XP_006599726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like isoform X2 [Glycine max] gi|571530389|ref|XP_003548320.2| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like isoform X1 [Glycine max] Length = 591 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYN MARR+AL+QKRKSMSLRGK Sbjct: 562 SEHMRKFYNHGMARRYALSQKRKSMSLRGK 591 >ref|XP_004162522.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Cucumis sativus] Length = 559 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYN AMARRF+LNQKR S+SLRGK Sbjct: 530 SEHMRKFYNRAMARRFSLNQKRMSVSLRGK 559 >ref|XP_004138939.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Cucumis sativus] Length = 559 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 SEHMRKFYNPAMARRFALNQKRKSMSLRGK 90 SEHMRKFYN AMARRF+LNQKR S+SLRGK Sbjct: 530 SEHMRKFYNRAMARRFSLNQKRMSVSLRGK 559