BLASTX nr result
ID: Mentha26_contig00040841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040841 (768 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25030.1| hypothetical protein MIMGU_mgv1a019394mg [Mimulus... 87 6e-15 >gb|EYU25030.1| hypothetical protein MIMGU_mgv1a019394mg [Mimulus guttatus] Length = 237 Score = 87.0 bits (214), Expect = 6e-15 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 2/98 (2%) Frame = -2 Query: 476 MSHVEEDPFMMSALKGCSWPSSSMDLAYNCNPLSEVIAINDKTRK-DVQGNGGPSTWAPL 300 ++H +E+ M++ +WP +MDL Y CNPLSEV+A+N+K + +VQ + PS W PL Sbjct: 144 INHGQENVTMVNL----AWPQPAMDLGYECNPLSEVVALNNKAGEINVQVDEAPSPWVPL 199 Query: 299 PPL-ESRYGYQDSNSWDXXXXANIGWESELHYVVPSVL 189 P L + +YGY ++++W ANI W+SELH VVPSVL Sbjct: 200 PTLDDGQYGYCENSNW--ISGANISWDSELHCVVPSVL 235