BLASTX nr result
ID: Mentha26_contig00040712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040712 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46893.1| hypothetical protein MIMGU_mgv1a000330mg [Mimulus... 112 7e-23 ref|XP_007051344.1| Uncharacterized protein isoform 1 [Theobroma... 109 5e-22 ref|XP_007221462.1| hypothetical protein PRUPE_ppa000439mg [Prun... 106 4e-21 ref|XP_002282028.2| PREDICTED: paladin [Vitis vinifera] 105 5e-21 emb|CBI37075.3| unnamed protein product [Vitis vinifera] 105 5e-21 emb|CAN67124.1| hypothetical protein VITISV_040165 [Vitis vinifera] 105 5e-21 ref|XP_007163266.1| hypothetical protein PHAVU_001G220000g [Phas... 105 9e-21 ref|XP_003520779.1| PREDICTED: paladin-like isoform X1 [Glycine ... 105 9e-21 ref|XP_006605769.1| PREDICTED: paladin-like isoform X2 [Glycine ... 102 6e-20 ref|XP_003555761.1| PREDICTED: paladin-like isoform X1 [Glycine ... 102 6e-20 ref|XP_006589084.1| PREDICTED: paladin-like isoform X4 [Glycine ... 102 7e-20 ref|XP_006589082.1| PREDICTED: paladin-like isoform X2 [Glycine ... 102 7e-20 ref|XP_003535306.1| PREDICTED: paladin-like isoform X1 [Glycine ... 102 7e-20 ref|XP_006375411.1| hypothetical protein POPTR_0014s10550g [Popu... 100 2e-19 ref|XP_003626100.1| Paladin [Medicago truncatula] gi|355501115|g... 100 2e-19 ref|XP_004495834.1| PREDICTED: paladin-like [Cicer arietinum] 100 3e-19 ref|XP_004494491.1| PREDICTED: paladin-like [Cicer arietinum] 100 3e-19 ref|XP_003554588.1| PREDICTED: paladin-like [Glycine max] 100 3e-19 ref|XP_003591287.1| Paladin [Medicago truncatula] gi|355480335|g... 100 3e-19 ref|XP_002515140.1| conserved hypothetical protein [Ricinus comm... 99 6e-19 >gb|EYU46893.1| hypothetical protein MIMGU_mgv1a000330mg [Mimulus guttatus] Length = 1250 Score = 112 bits (279), Expect = 7e-23 Identities = 53/61 (86%), Positives = 56/61 (91%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 DSDE+RAYLVDM IKALRRYFFLIAFRSYLYSTS T+ RF +WMDARPEL HLCNNLRID Sbjct: 1190 DSDEYRAYLVDMGIKALRRYFFLIAFRSYLYSTSATEIRFTSWMDARPELAHLCNNLRID 1249 Query: 182 R 184 R Sbjct: 1250 R 1250 >ref|XP_007051344.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508703605|gb|EOX95501.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1257 Score = 109 bits (272), Expect = 5e-22 Identities = 49/61 (80%), Positives = 55/61 (90%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DEHRAYL+DM IKALRRYFFLI FRSYLY TSP +T+F +WMDARPELGHLC+NLRID Sbjct: 1197 DDDEHRAYLMDMGIKALRRYFFLITFRSYLYCTSPIETKFTSWMDARPELGHLCSNLRID 1256 Query: 182 R 184 + Sbjct: 1257 K 1257 >ref|XP_007221462.1| hypothetical protein PRUPE_ppa000439mg [Prunus persica] gi|462418212|gb|EMJ22661.1| hypothetical protein PRUPE_ppa000439mg [Prunus persica] Length = 1183 Score = 106 bits (264), Expect = 4e-21 Identities = 48/61 (78%), Positives = 53/61 (86%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DEHRAYL+DM IKALRRYFFLI FRSYLY TS + +F +WMDARPELGHLCNNLRID Sbjct: 1123 DDDEHRAYLMDMGIKALRRYFFLITFRSYLYCTSAAEIKFASWMDARPELGHLCNNLRID 1182 Query: 182 R 184 + Sbjct: 1183 K 1183 >ref|XP_002282028.2| PREDICTED: paladin [Vitis vinifera] Length = 1257 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DEHRAYL+DM IKALRRYFFLI FRSYLY TS T+T F WMDARPELGHLCNNLR+D+ Sbjct: 1199 DEHRAYLMDMGIKALRRYFFLITFRSYLYCTSATETEFTAWMDARPELGHLCNNLRMDK 1257 >emb|CBI37075.3| unnamed protein product [Vitis vinifera] Length = 1255 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DEHRAYL+DM IKALRRYFFLI FRSYLY TS T+T F WMDARPELGHLCNNLR+D+ Sbjct: 1197 DEHRAYLMDMGIKALRRYFFLITFRSYLYCTSATETEFTAWMDARPELGHLCNNLRMDK 1255 >emb|CAN67124.1| hypothetical protein VITISV_040165 [Vitis vinifera] Length = 95 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DEHRAYL+DM IKALRRYFFLI FRSYLY TS T+T F WMDARPELGHLCNNLR+D+ Sbjct: 37 DEHRAYLMDMGIKALRRYFFLITFRSYLYCTSATETEFTAWMDARPELGHLCNNLRMDK 95 >ref|XP_007163266.1| hypothetical protein PHAVU_001G220000g [Phaseolus vulgaris] gi|561036730|gb|ESW35260.1| hypothetical protein PHAVU_001G220000g [Phaseolus vulgaris] Length = 1247 Score = 105 bits (261), Expect = 9e-21 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE RAYL+DM IKALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID Sbjct: 1187 DDDEERAYLMDMGIKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPELGHLCNNLRID 1246 Query: 182 R 184 + Sbjct: 1247 K 1247 >ref|XP_003520779.1| PREDICTED: paladin-like isoform X1 [Glycine max] Length = 1247 Score = 105 bits (261), Expect = 9e-21 Identities = 48/61 (78%), Positives = 50/61 (81%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE R YL+DM IKALRRYFFLI FRSYLY TSP T F WMDARPELGHLCNNLRID Sbjct: 1187 DDDEERGYLMDMGIKALRRYFFLITFRSYLYCTSPANTEFAAWMDARPELGHLCNNLRID 1246 Query: 182 R 184 + Sbjct: 1247 K 1247 >ref|XP_006605769.1| PREDICTED: paladin-like isoform X2 [Glycine max] Length = 1236 Score = 102 bits (254), Expect = 6e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID+ Sbjct: 1178 DEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPELGHLCNNLRIDK 1236 >ref|XP_003555761.1| PREDICTED: paladin-like isoform X1 [Glycine max] Length = 1256 Score = 102 bits (254), Expect = 6e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID+ Sbjct: 1198 DEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPELGHLCNNLRIDK 1256 >ref|XP_006589084.1| PREDICTED: paladin-like isoform X4 [Glycine max] Length = 1019 Score = 102 bits (253), Expect = 7e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID+ Sbjct: 961 DEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARPELGHLCNNLRIDK 1019 >ref|XP_006589082.1| PREDICTED: paladin-like isoform X2 [Glycine max] Length = 1236 Score = 102 bits (253), Expect = 7e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID+ Sbjct: 1178 DEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARPELGHLCNNLRIDK 1236 >ref|XP_003535306.1| PREDICTED: paladin-like isoform X1 [Glycine max] Length = 1256 Score = 102 bits (253), Expect = 7e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYLY TSP +F WMDARPELGHLCNNLRID+ Sbjct: 1198 DEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARPELGHLCNNLRIDK 1256 >ref|XP_006375411.1| hypothetical protein POPTR_0014s10550g [Populus trichocarpa] gi|550323925|gb|ERP53208.1| hypothetical protein POPTR_0014s10550g [Populus trichocarpa] Length = 1259 Score = 100 bits (250), Expect = 2e-19 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE RAYL+DM IKALRRYFFLI FRSYLYST ++T+F +WMD+RPEL HLCNNLR+D Sbjct: 1199 DDDEQRAYLMDMGIKALRRYFFLITFRSYLYSTKASETKFTSWMDSRPELRHLCNNLRMD 1258 Query: 182 R 184 + Sbjct: 1259 K 1259 >ref|XP_003626100.1| Paladin [Medicago truncatula] gi|355501115|gb|AES82318.1| Paladin [Medicago truncatula] Length = 1305 Score = 100 bits (249), Expect = 2e-19 Identities = 47/61 (77%), Positives = 48/61 (78%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE RAYL DM IKALRRYFFLI FRSYLY SP T F WMDARPEL HLCNNLRID Sbjct: 1245 DDDEERAYLFDMGIKALRRYFFLITFRSYLYCNSPDDTEFAGWMDARPELSHLCNNLRID 1304 Query: 182 R 184 + Sbjct: 1305 K 1305 >ref|XP_004495834.1| PREDICTED: paladin-like [Cicer arietinum] Length = 1252 Score = 100 bits (248), Expect = 3e-19 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RAYL+DM +KALRRYFFLI FRSYL+ TSP+ F WMDARPELGHLCNNLRID+ Sbjct: 1194 DEERAYLMDMGVKALRRYFFLITFRSYLHCTSPSNLEFAAWMDARPELGHLCNNLRIDK 1252 >ref|XP_004494491.1| PREDICTED: paladin-like [Cicer arietinum] Length = 1249 Score = 100 bits (248), Expect = 3e-19 Identities = 46/61 (75%), Positives = 49/61 (80%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE RAYL+DM IKALRRYFFLI FRSYLY SP T F WMDARPEL HLCNNLRI+ Sbjct: 1189 DDDEERAYLMDMGIKALRRYFFLITFRSYLYCISPADTEFAAWMDARPELDHLCNNLRIE 1248 Query: 182 R 184 + Sbjct: 1249 K 1249 >ref|XP_003554588.1| PREDICTED: paladin-like [Glycine max] Length = 1247 Score = 100 bits (248), Expect = 3e-19 Identities = 46/61 (75%), Positives = 48/61 (78%) Frame = +2 Query: 2 DSDEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRID 181 D DE RAYL+DM IKALRRYFFLI FRSYLY SP F WMDARPEL HLCNNLRID Sbjct: 1187 DDDEERAYLMDMGIKALRRYFFLITFRSYLYCNSPANMEFAAWMDARPELAHLCNNLRID 1246 Query: 182 R 184 + Sbjct: 1247 K 1247 >ref|XP_003591287.1| Paladin [Medicago truncatula] gi|355480335|gb|AES61538.1| Paladin [Medicago truncatula] Length = 1253 Score = 100 bits (248), Expect = 3e-19 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE RA+L+DM +KALRRYFFLI FRSYLY TSP+ F WMDARPELGHLCNNLRID+ Sbjct: 1195 DEERAHLMDMGVKALRRYFFLITFRSYLYCTSPSNMEFAAWMDARPELGHLCNNLRIDK 1253 >ref|XP_002515140.1| conserved hypothetical protein [Ricinus communis] gi|223545620|gb|EEF47124.1| conserved hypothetical protein [Ricinus communis] Length = 1249 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/59 (74%), Positives = 51/59 (86%) Frame = +2 Query: 8 DEHRAYLVDMCIKALRRYFFLIAFRSYLYSTSPTQTRFITWMDARPELGHLCNNLRIDR 184 DE A+L+DM +KALRRYFFLI FRSYLY PT+TRF +WM+ARPELGHLCNNLRID+ Sbjct: 1191 DEQLAHLMDMGVKALRRYFFLITFRSYLYCAKPTETRFTSWMNARPELGHLCNNLRIDK 1249