BLASTX nr result
ID: Mentha26_contig00040504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040504 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34693.1| hypothetical protein MIMGU_mgv1a025583mg, partial... 57 3e-06 >gb|EYU34693.1| hypothetical protein MIMGU_mgv1a025583mg, partial [Mimulus guttatus] Length = 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 377 LSHSSIESAIMYPQLDYGQVKNLQADDIQGIRALYN 270 L HSS+E+AIMYP+L G+ K L ADDIQGIRALYN Sbjct: 127 LGHSSVEAAIMYPRLSSGRTKGLNADDIQGIRALYN 162