BLASTX nr result
ID: Mentha26_contig00040369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040369 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344209.1| PREDICTED: repressor of RNA polymerase III t... 74 3e-11 ref|XP_004238864.1| PREDICTED: repressor of RNA polymerase III t... 74 3e-11 ref|XP_002284050.1| PREDICTED: repressor of RNA polymerase III t... 72 8e-11 gb|EYU30440.1| hypothetical protein MIMGU_mgv1a013297mg [Mimulus... 71 1e-10 gb|EYU28199.1| hypothetical protein MIMGU_mgv1a0209581mg, partia... 71 1e-10 ref|XP_006468810.1| PREDICTED: repressor of RNA polymerase III t... 69 5e-10 ref|XP_006448309.1| hypothetical protein CICLE_v100165972mg [Cit... 69 5e-10 ref|NP_001275774.1| MAF1-like protein [Citrus sinensis] gi|35938... 69 5e-10 ref|XP_004299008.1| PREDICTED: repressor of RNA polymerase III t... 69 9e-10 ref|XP_004135064.1| PREDICTED: repressor of RNA polymerase III t... 69 9e-10 gb|AEM42993.1| transcription regulator [Siraitia grosvenorii] 67 3e-09 ref|XP_002537453.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 ref|XP_007225787.1| hypothetical protein PRUPE_ppa011222mg [Prun... 65 1e-08 emb|CAB86631.1| putative protein [Arabidopsis thaliana] 63 4e-08 gb|EXB65607.1| hypothetical protein L484_025873 [Morus notabilis] 63 5e-08 gb|AFK35163.1| unknown [Lotus japonicus] 63 5e-08 ref|XP_007032992.1| Repressor of RNA polymerase III transcriptio... 62 6e-08 ref|XP_007032990.1| Transcription regulators isoform 1 [Theobrom... 62 6e-08 ref|XP_003592566.1| Repressor of RNA polymerase III transcriptio... 62 6e-08 ref|XP_004496993.1| PREDICTED: repressor of RNA polymerase III t... 62 8e-08 >ref|XP_006344209.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog isoform X1 [Solanum tuberosum] gi|565354624|ref|XP_006344210.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog isoform X2 [Solanum tuberosum] Length = 224 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MKYL+YTPLDRINDFLSHV LG+RTI+GCLEAYSCK Sbjct: 1 MKYLEYTPLDRINDFLSHVNLGERTIKGCLEAYSCK 36 >ref|XP_004238864.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Solanum lycopersicum] Length = 224 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MKYL+YTPLDRINDFLSHV LG+RTI+GCLEAYSCK Sbjct: 1 MKYLEYTPLDRINDFLSHVNLGERTIKGCLEAYSCK 36 >ref|XP_002284050.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Vitis vinifera] gi|297737728|emb|CBI26929.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDRINDFLSHV LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLDRINDFLSHVNLGERTIKGCLEAYSCK 36 >gb|EYU30440.1| hypothetical protein MIMGU_mgv1a013297mg [Mimulus guttatus] Length = 224 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MKYL+YTPLDRINDFLS++ LG+RTIEGCLEAYSCK Sbjct: 1 MKYLEYTPLDRINDFLSNLNLGERTIEGCLEAYSCK 36 >gb|EYU28199.1| hypothetical protein MIMGU_mgv1a0209581mg, partial [Mimulus guttatus] Length = 141 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MKYL+YTPLDRINDFLS++ LG+RTIEGCLEAYSCK Sbjct: 1 MKYLEYTPLDRINDFLSNLNLGERTIEGCLEAYSCK 36 >ref|XP_006468810.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog isoform X1 [Citrus sinensis] Length = 224 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDRINDFL H+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLDRINDFLDHLNLGERTIKGCLEAYSCK 36 >ref|XP_006448309.1| hypothetical protein CICLE_v100165972mg [Citrus clementina] gi|557550920|gb|ESR61549.1| hypothetical protein CICLE_v100165972mg [Citrus clementina] Length = 224 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDRINDFL H+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLDRINDFLDHLNLGERTIKGCLEAYSCK 36 >ref|NP_001275774.1| MAF1-like protein [Citrus sinensis] gi|359386138|gb|AEV43358.1| MAF1-like protein [Citrus sinensis] Length = 224 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDRINDFL H+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLDRINDFLDHLNLGERTIKGCLEAYSCK 36 >ref|XP_004299008.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Fragaria vesca subsp. vesca] Length = 224 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDR+NDF SH+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLDRLNDFFSHLNLGERTIKGCLEAYSCK 36 >ref|XP_004135064.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Cucumis sativus] gi|449517303|ref|XP_004165685.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Cucumis sativus] Length = 224 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTP DR+NDFLSH+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPFDRLNDFLSHLNLGERTIKGCLEAYSCK 36 >gb|AEM42993.1| transcription regulator [Siraitia grosvenorii] Length = 224 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTP +R+NDFLSH+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPFERLNDFLSHLNLGERTIKGCLEAYSCK 36 >ref|XP_002537453.1| conserved hypothetical protein [Ricinus communis] gi|223516296|gb|EEF24930.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPL+RIN+FLS++ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLERINEFLSNLNLGERTIQGCLEAYSCK 36 >ref|XP_007225787.1| hypothetical protein PRUPE_ppa011222mg [Prunus persica] gi|462422723|gb|EMJ26986.1| hypothetical protein PRUPE_ppa011222mg [Prunus persica] Length = 219 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPL+R+NDF SH+ LG RTI GCLEAYSCK Sbjct: 1 MKFLEYTPLERLNDFFSHLNLGGRTINGCLEAYSCK 36 >emb|CAB86631.1| putative protein [Arabidopsis thaliana] Length = 283 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 202 IMKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 IMK+L+YT LDR+N FL H+ LG+RTI+GCLEAYSCK Sbjct: 59 IMKFLEYTNLDRLNVFLGHLNLGERTIKGCLEAYSCK 95 >gb|EXB65607.1| hypothetical protein L484_025873 [Morus notabilis] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPL+RIN FLS + LG+RTI+GCLEAYSCK Sbjct: 1 MKFLEYTPLERINVFLSRLNLGERTIKGCLEAYSCK 36 >gb|AFK35163.1| unknown [Lotus japonicus] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+ PLDR+NDFL H+ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLECAPLDRLNDFLCHLNLGERTIKGCLEAYSCK 36 >ref|XP_007032992.1| Repressor of RNA polymerase III transcription MAF1 isoform 3, partial [Theobroma cacao] gi|508712021|gb|EOY03918.1| Repressor of RNA polymerase III transcription MAF1 isoform 3, partial [Theobroma cacao] Length = 183 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDR+NDFLS + LG+RTI+G LEAYSCK Sbjct: 1 MKFLEYTPLDRLNDFLSALNLGERTIKGSLEAYSCK 36 >ref|XP_007032990.1| Transcription regulators isoform 1 [Theobroma cacao] gi|590651826|ref|XP_007032991.1| Transcription regulators isoform 1 [Theobroma cacao] gi|508712019|gb|EOY03916.1| Transcription regulators isoform 1 [Theobroma cacao] gi|508712020|gb|EOY03917.1| Transcription regulators isoform 1 [Theobroma cacao] Length = 224 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+YTPLDR+NDFLS + LG+RTI+G LEAYSCK Sbjct: 1 MKFLEYTPLDRLNDFLSALNLGERTIKGSLEAYSCK 36 >ref|XP_003592566.1| Repressor of RNA polymerase III transcription MAF1-like protein [Medicago truncatula] gi|355481614|gb|AES62817.1| Repressor of RNA polymerase III transcription MAF1-like protein [Medicago truncatula] Length = 285 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/39 (64%), Positives = 36/39 (92%) Frame = +1 Query: 196 TYIMKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 ++IMK+L+ PLDR++DFLS++ LG+RTI+GC+EAYSCK Sbjct: 52 SFIMKFLECAPLDRLSDFLSNLNLGERTIKGCIEAYSCK 90 >ref|XP_004496993.1| PREDICTED: repressor of RNA polymerase III transcription MAF1 homolog [Cicer arietinum] Length = 224 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 205 MKYLDYTPLDRINDFLSHVTLGQRTIEGCLEAYSCK 312 MK+L+ PLDR+NDFLS++ LG+RTI+GCLEAYSCK Sbjct: 1 MKFLECAPLDRLNDFLSNLNLGERTIKGCLEAYSCK 36