BLASTX nr result
ID: Mentha26_contig00040368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040368 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372963.1| TraB family protein [Populus trichocarpa] gi... 59 9e-07 ref|XP_004251511.1| PREDICTED: traB domain-containing protein-li... 59 9e-07 ref|XP_006351958.1| PREDICTED: traB domain-containing protein-li... 57 3e-06 ref|XP_003540849.1| PREDICTED: traB domain-containing protein-li... 56 4e-06 >ref|XP_006372963.1| TraB family protein [Populus trichocarpa] gi|550319611|gb|ERP50760.1| TraB family protein [Populus trichocarpa] Length = 334 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +2 Query: 2 VELKQLLSMPTEKSAITVTKVLTSIGATVAGVAIISGIYLSIKK 133 +ELK L+ +P++KSA++ KVL S+G VAGVAI+SGIYLS KK Sbjct: 291 IELKDLMELPSQKSAVSAWKVLASLGVAVAGVAIVSGIYLSRKK 334 >ref|XP_004251511.1| PREDICTED: traB domain-containing protein-like [Solanum lycopersicum] Length = 415 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +2 Query: 2 VELKQLLSMPTEKSAITVTKVLTSIGATVAGVAIISGIYLSIKK 133 +E+K+LLS+P+ K ITV+K++T++G VAGVAIISGIY+S KK Sbjct: 372 IEVKELLSIPSPKPLITVSKIVTTLGVAVAGVAIISGIYVSSKK 415 >ref|XP_006351958.1| PREDICTED: traB domain-containing protein-like [Solanum tuberosum] Length = 347 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +2 Query: 2 VELKQLLSMPTEKSAITVTKVLTSIGATVAGVAIISGIYLSIKK 133 +E+K+LLS+P+ K I+V K++T++G VAGVAIISGIY+S KK Sbjct: 304 IEVKELLSIPSPKPLISVAKIVTTLGVAVAGVAIISGIYVSSKK 347 >ref|XP_003540849.1| PREDICTED: traB domain-containing protein-like [Glycine max] Length = 403 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +2 Query: 2 VELKQLLSMPTEKSAITVTKVLTSIGATVAGVAIISGIYLSIKK 133 V +K L+++P+ K A++ T+++TSIG VAGVAIISGIYLS KK Sbjct: 360 VVMKDLMTVPSPKPAVSATRIVTSIGVAVAGVAIISGIYLSCKK 403