BLASTX nr result
ID: Mentha26_contig00040139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040139 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384485.1| hypothetical protein POPTR_0004s15500g, part... 56 6e-06 >ref|XP_006384485.1| hypothetical protein POPTR_0004s15500g, partial [Populus trichocarpa] gi|550341103|gb|ERP62282.1| hypothetical protein POPTR_0004s15500g, partial [Populus trichocarpa] Length = 87 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/82 (45%), Positives = 48/82 (58%), Gaps = 4/82 (4%) Frame = +1 Query: 31 LIMSGLVDIWTAEQAKLKSKGQAGLSTGSAPAPGQAAANEKKGAGSSLWWQAGLARVE-- 204 L MSGLVDIWT E AKL+ KGQA S+GS+P +++ GS + A + Sbjct: 5 LAMSGLVDIWTGELAKLREKGQAVWSSGSSPTNVESSKVVPGEEGSLRLVKPLPASIRGM 64 Query: 205 --KLPALHCSEASFSMLMDSIS 264 K PAL SEAS SML+D ++ Sbjct: 65 RVKSPALTYSEASLSMLVDCLN 86