BLASTX nr result
ID: Mentha26_contig00040000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00040000 (604 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265556.2| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 63 7e-08 emb|CBI24136.3| unnamed protein product [Vitis vinifera] 63 7e-08 ref|XP_007022767.1| Copine I-like protein isoform 3 [Theobroma c... 62 1e-07 ref|XP_007022766.1| Ca(2)-dependent phospholipid-binding protein... 62 1e-07 ref|XP_007022765.1| Ca(2)-dependent phospholipid-binding protein... 62 1e-07 ref|XP_007211456.1| hypothetical protein PRUPE_ppa007341mg [Prun... 62 1e-07 ref|XP_004172545.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 62 1e-07 ref|XP_004139915.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 62 1e-07 ref|XP_002527586.1| copine, putative [Ricinus communis] gi|22353... 62 1e-07 ref|XP_006422305.1| hypothetical protein CICLE_v10005036mg [Citr... 62 2e-07 ref|XP_006422304.1| hypothetical protein CICLE_v10005036mg [Citr... 62 2e-07 ref|XP_006422303.1| hypothetical protein CICLE_v10005036mg [Citr... 62 2e-07 ref|XP_006422302.1| hypothetical protein CICLE_v10005036mg [Citr... 62 2e-07 ref|XP_007133451.1| hypothetical protein PHAVU_011G179700g [Phas... 61 2e-07 ref|XP_006598025.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 ref|XP_006598024.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 ref|XP_006585726.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 ref|XP_006585725.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 ref|XP_003546661.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 ref|XP_003531811.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2... 60 4e-07 >ref|XP_002265556.2| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Vitis vinifera] Length = 450 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 + S YPLSI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 260 VTASSYPLSIILVGVGDGPWDDMKKFDDKIPA 291 >emb|CBI24136.3| unnamed protein product [Vitis vinifera] Length = 5665 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 + S YPLSI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 5475 VTASSYPLSIILVGVGDGPWDDMKKFDDKIPA 5506 >ref|XP_007022767.1| Copine I-like protein isoform 3 [Theobroma cacao] gi|508722395|gb|EOY14292.1| Copine I-like protein isoform 3 [Theobroma cacao] Length = 318 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSIVL+GVGDGPWDDMKKFDDKIPA Sbjct: 222 SSYPLSIVLVGVGDGPWDDMKKFDDKIPA 250 >ref|XP_007022766.1| Ca(2)-dependent phospholipid-binding protein family isoform 2 [Theobroma cacao] gi|508722394|gb|EOY14291.1| Ca(2)-dependent phospholipid-binding protein family isoform 2 [Theobroma cacao] Length = 388 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSIVL+GVGDGPWDDMKKFDDKIPA Sbjct: 221 SSYPLSIVLVGVGDGPWDDMKKFDDKIPA 249 >ref|XP_007022765.1| Ca(2)-dependent phospholipid-binding protein family isoform 1 [Theobroma cacao] gi|508722393|gb|EOY14290.1| Ca(2)-dependent phospholipid-binding protein family isoform 1 [Theobroma cacao] Length = 426 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSIVL+GVGDGPWDDMKKFDDKIPA Sbjct: 259 SSYPLSIVLVGVGDGPWDDMKKFDDKIPA 287 >ref|XP_007211456.1| hypothetical protein PRUPE_ppa007341mg [Prunus persica] gi|462407321|gb|EMJ12655.1| hypothetical protein PRUPE_ppa007341mg [Prunus persica] Length = 371 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 SFYPLSIVL+GVGDGPW+DM+KFDDK+PA Sbjct: 204 SFYPLSIVLVGVGDGPWEDMRKFDDKLPA 232 >ref|XP_004172545.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like, partial [Cucumis sativus] Length = 264 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 97 SAYPLSIILVGVGDGPWDDMKKFDDKIPA 125 >ref|XP_004139915.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus] Length = 409 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 252 SAYPLSIILVGVGDGPWDDMKKFDDKIPA 280 >ref|XP_002527586.1| copine, putative [Ricinus communis] gi|223533045|gb|EEF34806.1| copine, putative [Ricinus communis] Length = 213 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 48 SSYPLSIILVGVGDGPWDDMKKFDDKIPA 76 >ref|XP_006422305.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] gi|568881798|ref|XP_006493738.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 [Citrus sinensis] gi|557524178|gb|ESR35545.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] Length = 422 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 +A S YPLSIVL+GVGDGPW+DM+KFDDKIPA Sbjct: 256 VAASSYPLSIVLVGVGDGPWEDMQKFDDKIPA 287 >ref|XP_006422304.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] gi|568881800|ref|XP_006493739.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 [Citrus sinensis] gi|568881802|ref|XP_006493740.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 [Citrus sinensis] gi|557524177|gb|ESR35544.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] Length = 386 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 +A S YPLSIVL+GVGDGPW+DM+KFDDKIPA Sbjct: 220 VAASSYPLSIVLVGVGDGPWEDMQKFDDKIPA 251 >ref|XP_006422303.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] gi|557524176|gb|ESR35543.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] Length = 337 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 +A S YPLSIVL+GVGDGPW+DM+KFDDKIPA Sbjct: 256 VAASSYPLSIVLVGVGDGPWEDMQKFDDKIPA 287 >ref|XP_006422302.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] gi|557524175|gb|ESR35542.1| hypothetical protein CICLE_v10005036mg [Citrus clementina] Length = 314 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 96 IAISFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 +A S YPLSIVL+GVGDGPW+DM+KFDDKIPA Sbjct: 148 VAASSYPLSIVLVGVGDGPWEDMQKFDDKIPA 179 >ref|XP_007133451.1| hypothetical protein PHAVU_011G179700g [Phaseolus vulgaris] gi|593262546|ref|XP_007133452.1| hypothetical protein PHAVU_011G179700g [Phaseolus vulgaris] gi|561006451|gb|ESW05445.1| hypothetical protein PHAVU_011G179700g [Phaseolus vulgaris] gi|561006452|gb|ESW05446.1| hypothetical protein PHAVU_011G179700g [Phaseolus vulgaris] Length = 408 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YP+SI+L+GVGDGPWDDMKKFDDKIPA Sbjct: 241 SSYPMSIILVGVGDGPWDDMKKFDDKIPA 269 >ref|XP_006598025.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X5 [Glycine max] Length = 323 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 156 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 184 >ref|XP_006598024.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 [Glycine max] Length = 408 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 241 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 269 >ref|XP_006585726.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X6 [Glycine max] Length = 323 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 156 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 184 >ref|XP_006585725.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X5 [Glycine max] Length = 368 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 201 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 229 >ref|XP_003546661.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 [Glycine max] gi|571520585|ref|XP_006598022.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 [Glycine max] gi|571520590|ref|XP_006598023.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 [Glycine max] Length = 417 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 250 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 278 >ref|XP_003531811.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 [Glycine max] gi|571472801|ref|XP_006585722.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 [Glycine max] gi|571472803|ref|XP_006585723.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 [Glycine max] gi|571472805|ref|XP_006585724.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 [Glycine max] Length = 425 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 87 SFYPLSIVLIGVGDGPWDDMKKFDDKIPA 1 S YPLSI+L+GVGDGPW+DMKKFDDKIPA Sbjct: 258 SSYPLSIILVGVGDGPWEDMKKFDDKIPA 286