BLASTX nr result
ID: Mentha26_contig00039655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039655 (647 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Mimulus... 64 4e-08 gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Mimulus... 64 4e-08 gb|EPS57826.1| hypothetical protein M569_16991, partial [Genlise... 61 3e-07 ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts... 58 3e-06 ref|XP_004230442.1| PREDICTED: uncharacterized protein LOC101264... 58 3e-06 >gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Mimulus guttatus] Length = 521 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 96 MKGPLDRTKVVLRHLPPTISQSNLVEHIDSRF 1 MKG +DRTKVVLRHLPPTISQSNLVEH+DSRF Sbjct: 1 MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRF 32 >gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Mimulus guttatus] Length = 522 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 96 MKGPLDRTKVVLRHLPPTISQSNLVEHIDSRF 1 MKG +DRTKVVLRHLPPTISQSNLVEH+DSRF Sbjct: 1 MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRF 32 >gb|EPS57826.1| hypothetical protein M569_16991, partial [Genlisea aurea] Length = 484 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 96 MKGPLDRTKVVLRHLPPTISQSNLVEHIDSRF 1 MKGPLDRTKVVLRHLPP+IS+SNLVE IDSRF Sbjct: 1 MKGPLDRTKVVLRHLPPSISESNLVELIDSRF 32 >ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Solanum tuberosum] Length = 483 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 96 MKGPLDRTKVVLRHLPPTISQSNLVEHIDSRF 1 MKGPLDR+KVVLRHLPPTISQS L++ +DSRF Sbjct: 1 MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRF 32 >ref|XP_004230442.1| PREDICTED: uncharacterized protein LOC101264766 [Solanum lycopersicum] Length = 485 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 96 MKGPLDRTKVVLRHLPPTISQSNLVEHIDSRF 1 MKGPLDR+KVVLRHLPPTISQS L++ +DSRF Sbjct: 1 MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRF 32