BLASTX nr result
ID: Mentha26_contig00039594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039594 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73344.1| hypothetical protein M569_01412, partial [Genlise... 61 2e-07 ref|XP_006348193.1| PREDICTED: gamma-tubulin complex component 2... 57 3e-06 ref|XP_002529877.1| gamma-tubulin complex component, putative [R... 57 3e-06 ref|XP_002273947.2| PREDICTED: gamma-tubulin complex component 2... 56 4e-06 emb|CBI34898.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_004164571.1| PREDICTED: gamma-tubulin complex component 2... 55 1e-05 ref|XP_004148270.1| PREDICTED: spindle pole body component 97-li... 55 1e-05 >gb|EPS73344.1| hypothetical protein M569_01412, partial [Genlisea aurea] Length = 151 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 333 GVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 GV+KPIGC+H A+QELIVIDDLLSALVGI+GR Sbjct: 49 GVDKPIGCYHVAVQELIVIDDLLSALVGIEGR 80 >ref|XP_006348193.1| PREDICTED: gamma-tubulin complex component 2-like [Solanum tuberosum] Length = 707 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/64 (43%), Positives = 38/64 (59%) Frame = +3 Query: 237 LRRSKLMDEHHKHVLVEPSNQLLRAPTEPLIPGVEKPIGCFHAAIQELIVIDDLLSALVG 416 L R L + ++ + P + + G +K IGC+HA IQELIVIDDLLS L+G Sbjct: 18 LDRPFLTGQFYQETKITPGTTEYKGVSADSSSGADKAIGCYHATIQELIVIDDLLSTLIG 77 Query: 417 IDGR 428 I+GR Sbjct: 78 IEGR 81 >ref|XP_002529877.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223530653|gb|EEF32527.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 713 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 330 PGVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 PG++K IGC+ AA+QELIVIDDL+SALVGI+GR Sbjct: 48 PGLDKAIGCYDAAVQELIVIDDLMSALVGIEGR 80 >ref|XP_002273947.2| PREDICTED: gamma-tubulin complex component 2-like [Vitis vinifera] Length = 681 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 318 EPLIPGVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 + L G+EK I C+HA++QELIVIDDLLSALVGI+GR Sbjct: 41 DSLNTGLEKAIACYHASVQELIVIDDLLSALVGIEGR 77 >emb|CBI34898.3| unnamed protein product [Vitis vinifera] Length = 702 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 318 EPLIPGVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 + L G+EK I C+HA++QELIVIDDLLSALVGI+GR Sbjct: 41 DSLNTGLEKAIACYHASVQELIVIDDLLSALVGIEGR 77 >ref|XP_004164571.1| PREDICTED: gamma-tubulin complex component 2-like [Cucumis sativus] Length = 295 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 333 GVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 G+EK IGC+ AAIQELIVIDDLLSAL+GI+GR Sbjct: 50 GLEKAIGCYDAAIQELIVIDDLLSALLGIEGR 81 >ref|XP_004148270.1| PREDICTED: spindle pole body component 97-like [Cucumis sativus] Length = 707 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 333 GVEKPIGCFHAAIQELIVIDDLLSALVGIDGR 428 G+EK IGC+ AAIQELIVIDDLLSAL+GI+GR Sbjct: 50 GLEKAIGCYDAAIQELIVIDDLLSALLGIEGR 81