BLASTX nr result
ID: Mentha26_contig00039556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039556 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 62 7e-12 gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partia... 57 3e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 62.4 bits (150), Expect(3) = 7e-12 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 500 VHFKTSIIPSRTKHESFDSFGSHAQLFRVNSHSFF 396 + F+ SIIPSRTKHESFDSFGSHAQL +VNSH FF Sbjct: 8 IPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFF 42 Score = 27.3 bits (59), Expect(3) = 7e-12 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = -3 Query: 399 FYECNEPI---LFIVQKTKKKTNLI 334 FYECNEPI LFI QK +TN+I Sbjct: 42 FYECNEPIFSSLFIFQK-DIETNVI 65 Score = 25.8 bits (55), Expect(3) = 7e-12 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 322 YLEDSSDKIKNM 287 Y EDSSDKIKNM Sbjct: 68 YSEDSSDKIKNM 79 >gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partial [Mimulus guttatus] Length = 71 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 500 VHFKTSIIPSRTKHESFDSFGSHAQLFRVNSHSFFMN 390 VHFKTSIIPSRTKHESFD FGSHAQL R +FF N Sbjct: 15 VHFKTSIIPSRTKHESFDLFGSHAQLLR----TFFGN 47