BLASTX nr result
ID: Mentha26_contig00039529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039529 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348740.1| PREDICTED: ribonuclease H2 subunit B-like is... 60 2e-07 ref|XP_006348739.1| PREDICTED: ribonuclease H2 subunit B-like is... 60 2e-07 ref|XP_004239098.1| PREDICTED: ribonuclease H2 subunit B-like [S... 60 3e-07 >ref|XP_006348740.1| PREDICTED: ribonuclease H2 subunit B-like isoform X2 [Solanum tuberosum] Length = 332 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = -3 Query: 166 SSPESEIFCLLPQKMDWWEGADETRVLIAQDPSTSEKNQGSILSLRHPRTGNTAC 2 SSP C+ M WWEG DE RVLIA++PS +LSLRHP++GN C Sbjct: 41 SSPPRGFSCVRKVSMAWWEGLDEARVLIAKEPSKDGDKVEQLLSLRHPKSGNATC 95 >ref|XP_006348739.1| PREDICTED: ribonuclease H2 subunit B-like isoform X1 [Solanum tuberosum] Length = 333 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = -3 Query: 166 SSPESEIFCLLPQKMDWWEGADETRVLIAQDPSTSEKNQGSILSLRHPRTGNTAC 2 SSP C+ M WWEG DE RVLIA++PS +LSLRHP++GN C Sbjct: 41 SSPPRGFSCVRKVSMAWWEGLDEARVLIAKEPSKDGDKVEQLLSLRHPKSGNATC 95 >ref|XP_004239098.1| PREDICTED: ribonuclease H2 subunit B-like [Solanum lycopersicum] Length = 333 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = -3 Query: 163 SPESEIFCLLPQKMDWWEGADETRVLIAQDPSTSEKNQGSILSLRHPRTGNTAC 2 SP C+ M WWEG DE RVLIA++PS +LSLRHP++GN C Sbjct: 42 SPPRGFSCVRKSSMAWWEGLDEARVLIAKEPSKDGNKVEQLLSLRHPKSGNATC 95