BLASTX nr result
ID: Mentha26_contig00039273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039273 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20890.1| hypothetical protein MIMGU_mgv1a004815mg [Mimulus... 92 7e-17 gb|EPS61814.1| hypothetical protein M569_12979, partial [Genlise... 71 1e-10 >gb|EYU20890.1| hypothetical protein MIMGU_mgv1a004815mg [Mimulus guttatus] Length = 509 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/61 (67%), Positives = 54/61 (88%) Frame = +3 Query: 216 NVENHQVINVTPVVLVESVPSKDIVRCARISVSGLSRLKVGSYSSAHRITFVPSDDIHER 395 +V+N QV+N TP+V+ ESVPSKD+VRCAR++VSGLSR K+G YSSAHR+T +PSD+I E+ Sbjct: 35 DVKNRQVVNATPIVIGESVPSKDVVRCARVTVSGLSRQKLGYYSSAHRVTLLPSDEIQEK 94 Query: 396 S 398 S Sbjct: 95 S 95 >gb|EPS61814.1| hypothetical protein M569_12979, partial [Genlisea aurea] Length = 457 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/61 (57%), Positives = 45/61 (73%) Frame = +3 Query: 216 NVENHQVINVTPVVLVESVPSKDIVRCARISVSGLSRLKVGSYSSAHRITFVPSDDIHER 395 +V N Q +N TP++L ES SK + CAR+ VSGLSRLK+GSYSS R+T VPSD I E+ Sbjct: 5 DVNNLQAVNATPILLDESALSKQPLWCARVPVSGLSRLKLGSYSSIRRVTLVPSDTIPEK 64 Query: 396 S 398 + Sbjct: 65 A 65