BLASTX nr result
ID: Mentha26_contig00039215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00039215 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44513.1| hypothetical protein MIMGU_mgv1a005869mg [Mimulus... 60 4e-07 >gb|EYU44513.1| hypothetical protein MIMGU_mgv1a005869mg [Mimulus guttatus] Length = 467 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/35 (88%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -1 Query: 465 VKRSTQYLMEYQSQYMFSEVGTGEGDE-EANAMVS 364 VKRSTQYLMEYQSQYMFSEV GEGDE E NAMVS Sbjct: 433 VKRSTQYLMEYQSQYMFSEVPAGEGDEDETNAMVS 467