BLASTX nr result
ID: Mentha26_contig00038895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038895 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22905.1| hypothetical protein MIMGU_mgv1a003315mg [Mimulus... 59 5e-07 >gb|EYU22905.1| hypothetical protein MIMGU_mgv1a003315mg [Mimulus guttatus] Length = 593 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 2 ILQCLQVDPSLRPTAAQLLDHPFVKRPLSSSA 97 I++CLQV+PSLRPTAAQLLDHPFVKRPL SS+ Sbjct: 548 IVKCLQVNPSLRPTAAQLLDHPFVKRPLPSSS 579