BLASTX nr result
ID: Mentha26_contig00038745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038745 (865 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39418.1| hypothetical protein MIMGU_mgv1a000556mg [Mimulus... 69 3e-09 >gb|EYU39418.1| hypothetical protein MIMGU_mgv1a000556mg [Mimulus guttatus] Length = 1080 Score = 68.6 bits (166), Expect = 3e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 117 LAEKVYPLLLLFPAERKNETVSYEGDMTVSDIIKLLAAHGS 239 L +VYPLLLLFPAERKN TV YEGD+ VSDIIK LAAHGS Sbjct: 825 LQREVYPLLLLFPAERKNNTVPYEGDVAVSDIIKFLAAHGS 865