BLASTX nr result
ID: Mentha26_contig00038613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038613 (620 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341809.1| PREDICTED: uncharacterized protein LOC102583... 64 3e-08 >ref|XP_006341809.1| PREDICTED: uncharacterized protein LOC102583026 [Solanum tuberosum] Length = 59 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -2 Query: 301 MDIYEKNGLSWADQWDPQ-PVPSEMPDKEKDDSQKSKNKLLKWVKSLCKKSKSGSQK 134 M+++ GLSWADQWDP+ P P DK+K SKNK LKW KSL KKSK+ Q+ Sbjct: 1 MEVFRSEGLSWADQWDPESPAPPHKDDKKK-SKNASKNKFLKWFKSLGKKSKNKQQE 56