BLASTX nr result
ID: Mentha26_contig00038509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038509 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36543.1| hypothetical protein MIMGU_mgv1a000754mg [Mimulus... 58 2e-06 >gb|EYU36543.1| hypothetical protein MIMGU_mgv1a000754mg [Mimulus guttatus] Length = 994 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = +1 Query: 136 LKLPGNSVFADEEVESEPEPLPKKDTKNTRTAPQEIE--SVDVQKNSVAE 279 LKLPG S F+DEEV+SEPEPL KK+ KN RT Q++E S+ + N + E Sbjct: 325 LKLPGKSAFSDEEVDSEPEPLLKKEIKNPRTTTQDVEQPSITTKPNDLTE 374