BLASTX nr result
ID: Mentha26_contig00038488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038488 (605 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20687.1| hypothetical protein MIMGU_mgv1a008183mg [Mimulus... 91 3e-16 >gb|EYU20687.1| hypothetical protein MIMGU_mgv1a008183mg [Mimulus guttatus] Length = 382 Score = 90.5 bits (223), Expect = 3e-16 Identities = 44/52 (84%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -2 Query: 154 MEEENANTMNLDLNLGPVDNSSDGS-EPPSGSYPNVAMNLEDWLDGPVHRVR 2 M EEN +TMNLDLNLGPVDNSSD S EPPSGSYPNV MNLEDWLD PV RVR Sbjct: 1 MAEENTSTMNLDLNLGPVDNSSDDSGEPPSGSYPNVTMNLEDWLDDPVQRVR 52